Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE NR1 LIGAND BINDING CORE IN COMPLEX WITH 5,7-DICHLOROKYNURENIC ACID (DCKA) AT 1.90 ANGSTROMS RESOLUTION
 
Authors :  H. Furukawa, E. Gouaux
Date :  14 May 03  (Deposition) - 29 Jul 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Ligand Binding Receptor, Rat, Nr1, Ligand Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Furukawa, E. Gouaux
Mechanisms Of Activation, Inhibition And Specificity: Crystal Structures Of The Nmda Receptor Nr1 Ligand-Binding Core
Embo J. V. 22 2873 2003
PubMed-ID: 12805203  |  Reference-DOI: 10.1093/EMBOJ/CDG303
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - N-METHYL-D-ASPARTATE RECEPTOR SUBUNIT 1
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET22B(+)
    Expression System StrainORIGAMIB (DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentLIGAND BINDING CORE
    GeneGRIN1 OR NMDAR1
    OrganFOREBRAIN
    Organism CommonNORWAY RAT
    Organism ScientificRATTUS NORVEGICUS
    Organism Taxid10116

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1DK12Ligand/Ion5,7-DICHLORO-4-HYDROXYQUINOLINE-2-CARBOXYLIC ACID

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLN A:13 , PHE A:16 , PHE A:92 , PRO A:124 , LEU A:125 , THR A:126 , ARG A:131 , TRP A:223 , PHE A:250 , HOH A:1036 , HOH A:1047 , HOH A:1078 , HOH A:1092 , HOH A:1111BINDING SITE FOR RESIDUE DK1 A 1001
2AC2SOFTWAREPHE B:16 , PHE B:92 , PRO B:124 , LEU B:125 , THR B:126 , ARG B:131 , TRP B:223 , ASP B:224 , HOH B:1016 , HOH B:1029 , HOH B:1053 , HOH B:1086 , HOH B:1184BINDING SITE FOR RESIDUE DK1 B 1002

(-) SS Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1A:28 -A:62
2A:44 -A:63
3A:236 -A:290
4B:28 -B:62
5B:44 -B:63
6B:236 -B:290

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Glu A:14 -Pro A:15
2Glu B:14 -Pro B:15

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PBQ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1PBQ)

(-) Exons   (9, 18)

Asymmetric/Biological Unit (9, 18)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000492971ENSRNOE00000310130chr3:3480369-3479901469NMDZ1_RAT1-86860--
1.2ENSRNOT000000492972ENSRNOE00000111277chr3:3478540-3478406135NMDZ1_RAT87-131450--
1.3ENSRNOT000000492973ENSRNOE00000111402chr3:3474895-3474719177NMDZ1_RAT132-190590--
1.5ENSRNOT000000492975ENSRNOE00000111535chr3:3471911-3471811101NMDZ1_RAT191-224340--
1.6ENSRNOT000000492976ENSRNOE00000114140chr3:3466978-3466857122NMDZ1_RAT224-265420--
1.7ENSRNOT000000492977ENSRNOE00000114576chr3:3466784-3466610175NMDZ1_RAT265-323590--
1.8ENSRNOT000000492978ENSRNOE00000111937chr3:3465637-3465493145NMDZ1_RAT323-371490--
1.9ENSRNOT000000492979ENSRNOE00000112066chr3:3465395-346531284NMDZ1_RAT372-399282A:5-7
B:5-7
3
3
1.10ENSRNOT0000004929710ENSRNOE00000112201chr3:3461058-3460917142NMDZ1_RAT400-447482A:8-46
B:8-45
39
38
1.11ENSRNOT0000004929711ENSRNOE00000112339chr3:3460834-3460707128NMDZ1_RAT447-489432A:59-97
B:60-96
39
37
1.12ENSRNOT0000004929712ENSRNOE00000112471chr3:3460461-3460297165NMDZ1_RAT490-544552A:98-152
B:104-152
55
49
1.13ENSRNOT0000004929713ENSRNOE00000112596chr3:3460222-3460104119NMDZ1_RAT545-584402A:153-154
B:153-154
2
2
1.14ENSRNOT0000004929714ENSRNOE00000112738chr3:3459988-3459876113NMDZ1_RAT584-622390--
1.15ENSRNOT0000004929715ENSRNOE00000112879chr3:3459799-3459651149NMDZ1_RAT622-671502A:155-163
B:155-163
9
9
1.16ENSRNOT0000004929716ENSRNOE00000113022chr3:3459544-3459387158NMDZ1_RAT672-724532A:164-216
B:164-216
53
53
1.17ENSRNOT0000004929717ENSRNOE00000115047chr3:3459215-3459054162NMDZ1_RAT724-778552A:216-270
B:216-270
55
55
1.18ENSRNOT0000004929718ENSRNOE00000331986chr3:3458645-3458536110NMDZ1_RAT778-815382A:270-290
B:270-291
21
22
1.19ENSRNOT0000004929719ENSRNOE00000347456chr3:3458452-3458307146NMDZ1_RAT815-863490--
1.20ENSRNOT0000004929720ENSRNOE00000118114chr3:3457054-3456944111NMDZ1_RAT864-900370--
1.21ENSRNOT0000004929721ENSRNOE00000259023chr3:3455031-34537841248NMDZ1_RAT901-938380--

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:274
 aligned with NMDZ1_RAT | P35439 from UniProtKB/Swiss-Prot  Length:938

    Alignment length:402
                                   406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796  
            NMDZ1_RAT   397 RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC 798
               SCOP domains d1pbqa_ A: N-methyl-D-aspartate receptor s            ubunit 1                                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1pbqA01 A:5-144,A:248-290 Periplasmic bind            ing protein-like II                                                                   1pbqA02 A:                                                                                                                    145-247 Periplasmic binding protein-like II                                                  1pbqA01 A:5-144,A:248-290                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeee.......eeee....................eeee.------------..eeeehhhhhhhhhhhhhhh..eeeee........eee......eeehhhhhhhhh....eeeeeee.hhhhhh..ee....eeeeeeeeee...--------------------------------------------------------------------------------------------------------------------......hhhhhh......ee....hhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhh....eeeeehhhhhhhhhhh..eeeeeeeeeeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) 1.9Exon 1.10  PDB: A:8-46 UniProt: 400-447         ------------------------------------------Exon 1.12  PDB: A:98-152 UniProt: 490-544              Exon 1.13  PDB: A:153-154 [INCOMPLETE]  -------------------------------------Exon 1.15  PDB: A:155-163 UniProt: 622-671        Exon 1.16  PDB: A:164-216 UniProt: 672-724           -----------------------------------------------------Exon 1.18             Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.11  PDB: A:59-97 UniProt: 447-489   ----------------------------------------------------------------------------------------------Exon 1.14  PDB: - UniProt: 584-622     -----------------------------------------------------------------------------------------------------Exon 1.17  PDB: A:216-270 UniProt: 724-778             -------------------- Transcript 1 (2)
                 1pbq A   5 RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTG------------VPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGT--------------------------------------------------------------------------------------------------------------------RITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC 290
                                    14        24        34        44 |       -    |   64        74        84        94       104       114       124       134       144       154         -         -         -         -         -         -         -         -         -         -         -      |158       168       178       188       198       208       218       228       238       248       258       268       278       288  
                                                                    46           59                                                                                            154                                                                                                                  155                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:266
 aligned with NMDZ1_RAT | P35439 from UniProtKB/Swiss-Prot  Length:938

    Alignment length:403
                                   406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796   
            NMDZ1_RAT   397 RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECD 799
               SCOP domains d1pbqb_ B: N-methyl-D-aspartate receptor               subunit 1                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1pbqB01 B:5-144,B:248-290 Periplasmic bin              ding protein-like II                                                                 1pbqB02 B:                                                                                                                    145-247 Periplasmic binding protein-like II                                                  1pbqB01 B:5-144,B:248-290                  - CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Lig_chan-1pbqB01 B:155-291                                                                                                                Pfam domains (1)
           Pfam domains (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Lig_chan-1pbqB02 B:155-291                                                                                                                Pfam domains (2)
           Pfam domains (3) -----------------------------------------              --SBP_bac_3-1pbqB03 B:62-287                                                                                                                                                                                                                                                                                                                            ---- Pfam domains (3)
           Pfam domains (4) -----------------------------------------              --SBP_bac_3-1pbqB04 B:62-287                                                                                                                                                                                                                                                                                                                            ---- Pfam domains (4)
         Sec.struct. author .eeeee.......eeee....................eeee--------------.eeeehhhhhhhhhhhhhh...eeeee..........-------...hhhhhhhhh....ee......hhhhhh..ee....eeeeeeeeee...--------------------------------------------------------------------------------------------------------------------......hhhhhh......ee....hhhhhhhhhh..hhhhhhhhh.....hhhhhhhhhhh....eeeeehhhhhhhhhhh..eeeeeeeeeeeee..ee.....hhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.9Exon 1.10  PDB: B:8-45 UniProt: 400-447         ------------------------------------------Exon 1.12  PDB: B:104-152 UniProt: 490-544 [INCOMPLETE]Exon 1.13  PDB: B:153-154 [INCOMPLETE]  -------------------------------------Exon 1.15  PDB: B:155-163 UniProt: 622-671        Exon 1.16  PDB: B:164-216 UniProt: 672-724           -----------------------------------------------------Exon 1.18 [INCOMPLETE] Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.11  PDB: B:60-96 UniProt: 447-489   ----------------------------------------------------------------------------------------------Exon 1.14  PDB: - UniProt: 584-622     -----------------------------------------------------------------------------------------------------Exon 1.17  PDB: B:216-270 UniProt: 724-778             --------------------- Transcript 1 (2)
                 1pbq B   5 RLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICT--------------PQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQE-------KEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGT--------------------------------------------------------------------------------------------------------------------RITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECD 291
                                    14        24        34        44|        -     |  64        74        84        94 |     104       114       124       134       144       154         -         -         -         -         -         -         -         -         -         -         -      |158       168       178       188       198       208       218       228       238       248       258       268       278       288   
                                                                   45             60                                  96     104                                               154                                                                                                                  155                                                                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Clan: PBP (391)

(-) Gene Ontology  (45, 45)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (NMDZ1_RAT | P35439)
molecular function
    GO:0004972    NMDA glutamate receptor activity    An cation channel that opens in response to binding by extracellular glutmate, but only if glycine is also bound and the membrane is depolarized. Voltage gating is indirect, due to ejection of bound magnesium from the pore at permissive voltages.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0005234    extracellular-glutamate-gated ion channel activity    Enables the transmembrane transfer of an ion by a channel that opens when extracellular glutamate has been bound by the channel complex or one of its constituent parts.
    GO:0016595    glutamate binding    Interacting selectively and non-covalently with glutamate, the anion of 2-aminopentanedioic acid.
    GO:0035254    glutamate receptor binding    Interacting selectively and non-covalently with a glutamate receptor.
    GO:0016594    glycine binding    Interacting selectively and non-covalently with glycine, aminoethanoic acid.
    GO:0005216    ion channel activity    Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
    GO:0004970    ionotropic glutamate receptor activity    Catalysis of the transmembrane transfer of an ion by a channel that opens when glutamate has been bound by the channel complex or one of its constituent parts.
    GO:0042165    neurotransmitter binding    Interacting selectively and non-covalently with a neurotransmitter, any chemical substance that is capable of transmitting (or inhibiting the transmission of) a nerve impulse from a neuron to another cell.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046983    protein dimerization activity    The formation of a protein dimer, a macromolecular structure consists of two noncovalently associated identical or nonidentical subunits.
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0022843    voltage-gated cation channel activity    Enables the transmembrane transfer of a cation by a voltage-gated channel. A cation is a positively charged ion. A voltage-gated channel is a channel whose open state is dependent on the voltage across the membrane in which it is embedded.
biological process
    GO:0071287    cellular response to manganese ion    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a manganese ion stimulus.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0035235    ionotropic glutamate receptor signaling pathway    A series of molecular signals initiated by glutamate binding to a glutamate receptor on the surface of the target cell, followed by the movement of ions through a channel in the receptor complex. Ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0007611    learning or memory    The acquisition and processing of information and/or the storage and retrieval of this information over time.
    GO:0010942    positive regulation of cell death    Any process that increases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
    GO:2000463    positive regulation of excitatory postsynaptic potential    Any process that enhances the establishment or increases the extent of the excitatory postsynaptic potential (EPSP) which is a temporary increase in postsynaptic potential due to the flow of positively charged ions into the postsynaptic cell. The flow of ions that causes an EPSP is an excitatory postsynaptic current (EPSC) and makes it easier for the neuron to fire an action potential.
    GO:0051262    protein tetramerization    The formation of a protein tetramer, a macromolecular structure consisting of four noncovalently associated identical or nonidentical subunits.
    GO:0034765    regulation of ion transmembrane transport    Any process that modulates the frequency, rate or extent of the directed movement of ions from one side of a membrane to the other.
    GO:0014075    response to amine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amine stimulus. An amine is a compound formally derived from ammonia by replacing one, two or three hydrogen atoms by hydrocarbyl groups.
    GO:0051592    response to calcium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
    GO:0060992    response to fungicide    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fungicide stimulus. Fungicides are chemicals used to kill fungi.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0048511    rhythmic process    Any process pertinent to the generation and maintenance of rhythms in the physiology of an organism.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0017146    NMDA selective glutamate receptor complex    An assembly of four or five subunits which form a structure with an extracellular N-terminus and a large loop that together form the ligand binding domain. The C-terminus is intracellular. The ionotropic glutamate receptor complex itself acts as a ligand gated ion channel; on binding glutamate, charged ions pass through a channel in the center of the receptor complex. NMDA receptors are composed of assemblies of NR1 subunits (Figure 3) and NR2 subunits, which can be one of four separate gene products (NR2A-D). Expression of both subunits are required to form functional channels. The glutamate binding domain is formed at the junction of NR1 and NR2 subunits. NMDA receptors are permeable to calcium ions as well as being permeable to other ions. Thus NMDA receptor activation leads to a calcium influx into the post-synaptic cells, a signal thought to be crucial for the induction of NMDA-receptor dependent LTP and LTD.
    GO:0030054    cell junction    A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
    GO:0032590    dendrite membrane    The portion of the plasma membrane surrounding a dendrite.
    GO:0044307    dendritic branch    A dendrite arising from another dendrite.
    GO:0043197    dendritic spine    A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
    GO:0060076    excitatory synapse    A synapse in which an action potential in the presynaptic cell increases the probability of an action potential occurring in the postsynaptic cell.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0014069    postsynaptic density of dendrite    An electron dense network of proteins within and adjacent to the postsynaptic membrane of the dendrite of asymetric synapses. Its major components include neurotransmitter receptors and the proteins that spatially and functionally organize them such as anchoring and scaffolding molecules, signaling enzymes and cytoskeletal components.
    GO:0045211    postsynaptic membrane    A specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters cross the synaptic cleft and transmit the signal to the postsynaptic membrane.
    GO:0045202    synapse    The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.
    GO:0043083    synaptic cleft    The narrow gap that separates the presynaptic and postsynaptic membranes, into which neurotransmitter is released.
    GO:0043195    terminal bouton    Terminal inflated portion of the axon, containing the specialized apparatus necessary to release neurotransmitters. The axon terminus is considered to be the whole region of thickening and the terminal bouton is a specialized region of it.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DK1  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:14 - Pro A:15   [ RasMol ]  
    Glu B:14 - Pro B:15   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pbq
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NMDZ1_RAT | P35439
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NMDZ1_RAT | P35439
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NMDZ1_RAT | P354391pb7 1pb8 1pb9 1y1m 1y1z 1y20 2a5t 3q41 4kcc 4kfq 4nf4 4nf5 4nf6 4nf8 4pe5 5ddn 5ddx 5de4 5dex 5fxg 5fxh 5fxi 5fxj 5fxk 5i56 5i57 5i58 5i59 5jty 5u8c 5vih 5vii 5vij

(-) Related Entries Specified in the PDB File

1pb7 1pb8 1pb9