1O1S - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF FPT BOUND TO ISOPRENOID ANALOG 3B

Authors :   T. C. Turek-Etienne, C. L. Strickland, M. D. Distefano

Date :   14 Jan 03 (Deposition) - 06 May 03 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym./Biol. Unit : A,B

Keywords :   Transferase, Prenyltransferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. C. Turek-Etienne, C. L. Strickland, M. D. Distefano
Biochemical And Structural Studies With Prenyl Diphosphate Analogues Provide Insights Into Isoprenoid Recognition By Protein Farnesyl Transferase
Biochemistry V. 42 3716 2003
PubMed-ID: 12667062 | Reference-DOI: 10.1021/BI0266838
(for further references see the PDB file header)

Molecule 1 - PROTEIN FARNESYLTRANSFERASE ALPHA SUBUNIT
	Chains	:	A
	EC Number	:	2.5.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET15B
	Expression System Taxid	:	562
	Expression System Vector	:	PLASMID
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	CAAX FARNESYLTRANSFERASE ALPHA SUBUNIT, RAS PROTEINS PRENYLTRANSFERASE ALPHA, FTASE-ALPHA

Molecule 2 - PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT
	Chains	:	B
	EC Number	:	2.5.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET15B
	Expression System Taxid	:	562
	Expression System Vector	:	PLASMID
	Fragment	:	RESIDUE 1-427
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	CAAX FARNESYLTRANSFERASE BETA SUBUNIT, RAS PROTEINS PRENYLTRANSFERASE BETA, FTASE-BETA

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 2)

No.	Name	Count	Type	Full Name
1	1NH	1	Ligand/Ion	(2E,6E)-8-[(3-BENZOYLBENZYL)OXY]-3,7-DIMETHYLOCTA-2,6-DIENYL TRIHYDROGEN DIPHOSPHATE
2	ZN	1	Ligand/Ion	ZINC ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP B:297 , CYS B:299 , HIS B:362 , HOH B:2380	BINDING SITE FOR RESIDUE ZN B 1001
2	AC2	SOFTWARE	LYS A:164 , TYR A:166 , TRP B:102 , ARG B:202 , CYS B:206 , HIS B:248 , GLY B:250 , TYR B:251 , ARG B:291 , LYS B:294 , TYR B:300 , TRP B:303 , HOH B:2009 , HOH B:2018 , HOH B:2031 , HOH B:2378	BINDING SITE FOR RESIDUE 1NH B 2001

(no "SS Bond" information available for 1O1S)

(no "Cis Peptide Bond" information available for 1O1S)

(no "SAP(SNP)/Variant" information available for 1O1S)

Asymmetric/Biological Unit (1, 5)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PFTA	PS51147	Protein prenyltransferases alpha subunit repeat profile.	FNTA_RAT	112-146 147-181 215-249 182-214 255-289	5	A:112-146 A:147-181 A:215-249 A:182-214 A:255-289

Asymmetric/Biological Unit (12, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000010588	1	ENSRNOE00000071243	chr6:99427967-99428155	189	FNTB_RAT	1-48	48	1	B:23-48	26
1.2	ENSRNOT00000010588	2	ENSRNOE00000071421	chr6:99447593-99447657	65	FNTB_RAT	49-70	22	1	B:49-70	22
1.3	ENSRNOT00000010588	3	ENSRNOE00000071602	chr6:99457445-99457517	73	FNTB_RAT	70-94	25	1	B:70-94	25
1.4	ENSRNOT00000010588	4	ENSRNOE00000071771	chr6:99459109-99459200	92	FNTB_RAT	95-125	31	1	B:95-125	31
1.5	ENSRNOT00000010588	5	ENSRNOE00000071976	chr6:99471356-99471502	147	FNTB_RAT	125-174	50	1	B:125-174	50
1.6	ENSRNOT00000010588	6	ENSRNOE00000072148	chr6:99471595-99471678	84	FNTB_RAT	174-202	29	1	B:174-202	29
1.7	ENSRNOT00000010588	7	ENSRNOE00000072321	chr6:99480586-99480672	87	FNTB_RAT	202-231	30	1	B:202-231	30
1.8	ENSRNOT00000010588	8	ENSRNOE00000072507	chr6:99489459-99489588	130	FNTB_RAT	231-274	44	1	B:231-274	44
1.9	ENSRNOT00000010588	9	ENSRNOE00000072695	chr6:99492633-99492765	133	FNTB_RAT	275-319	45	1	B:275-319	45
1.10	ENSRNOT00000010588	10	ENSRNOE00000072879	chr6:99504658-99504769	112	FNTB_RAT	319-356	38	1	B:319-356	38
1.11	ENSRNOT00000010588	11	ENSRNOE00000073070	chr6:99505820-99505934	115	FNTB_RAT	356-394	39	1	B:356-394	39
1.12	ENSRNOT00000010588	12	ENSRNOE00000238940	chr6:99510015-99511373	1359	FNTB_RAT	395-437	43	1	B:395-423	29

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:315
 aligned with FNTA_RAT | Q04631 from UniProtKB/Swiss-Prot  Length:377

    Alignment length:315
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363     
             FNTA_RAT    54 GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS 368
               SCOP domains d1o1sa_ A: Protein farnesyltransferase alpha-subunit                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1o1sA00 A:54-368  [code=1.25.40.120, no name defined]                                                                                                                                                                                                                                                                       CATH domains
           Pfam domains (1) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1o1sA01 A:258-288         -------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1o1sA02 A:258-288         -------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1o1sA03 A:258-288         -------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1o1sA04 A:258-288         -------------------------------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1o1sA05 A:258-288         -------------------------------------------------------------------------------- Pfam domains (5)
         Sec.struct. author ...................................ee..hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhh....hhhhhhhhhhhhhhh....hhhhhhhhhhhhh..hhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------PFTA  PDB: A:112-146               PFTA  PDB: A:147-181               PFTA  PDB: A:182-214             PFTA  PDB: A:215-249               -----PFTA  PDB: A:255-289               ------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1o1s A  54 GFLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS 368
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363

Chain B from PDB  Type:PROTEIN  Length:401
 aligned with FNTB_RAT | Q02293 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:401
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422 
             FNTB_RAT    23 LYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVMGVPENVLQPTHPVYNIGPDKVIQATTHFLQKPVPGF 423
               SCOP domains d1o1sb_ B: Protein farnesyltransferase, beta-subunit                                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1o1sB00 B:23-423  [code=1.50.10.20, no name defined]                                                                                                                                                                                                                                                                                                                                                              CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------Prenyltrans_2-1o1sB03 B:127-241                                                                                    ----------------------------------------------------------------------------------------Prenyltrans-1o1sB01 B:330-374                ------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Prenyltrans-1o1sB02 B:330-374                ------------------------------------------------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh.eehhhhhhhh.hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhh.........hhhhhhhh................hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh...................hhhhhh.hhhhhhhhhhhhh............hhhhhhhhhhhhh...............hhhhhhhhhhhhhhhheeee..eeee....hhhhh..........hhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:23-48    Exon 1.2  PDB: B:49-70------------------------Exon 1.4  PDB: B:95-125        ------------------------------------------------Exon 1.6  PDB: B:174-202     ----------------------------Exon 1.8  PDB: B:231-274 UniProt: 231-274   --------------------------------------------Exon 1.10  PDB: B:319-356             --------------------------------------Exon 1.12  PDB: B:395-423     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.3  PDB: B:70-94   ------------------------------Exon 1.5  PDB: B:125-174 UniProt: 125-174         ---------------------------Exon 1.7  PDB: B:202-231      -------------------------------------------Exon 1.9  PDB: B:275-319 UniProt: 275-319    ------------------------------------Exon 1.11  PDB: B:356-394              ----------------------------- Transcript 1 (2)
                 1o1s B  23 LYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVMGVPENVLQPTHPVYNIGPDKVIQATTHFLQKPVPGF 423
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: 6_Hairpin (120)

Family: Prenyltrans (49)

Rattus norvegicus (Rat) (31)

1a	Prenyltrans-1o1sB01	B:330-374
1b	Prenyltrans-1o1sB02	B:330-374

Family: Prenyltrans_2 (47)

Rattus norvegicus (Rat) (31)

Prenyltrans_2-1o1sB03

B:127-241

Clan: no clan defined [family: PPTA] (36)

Family: PPTA (36)

Rattus norvegicus (Rat) (31)

3a	PPTA-1o1sA01	A:258-288
3b	PPTA-1o1sA02	A:258-288
3c	PPTA-1o1sA03	A:258-288
3d	PPTA-1o1sA04	A:258-288
3e	PPTA-1o1sA05	A:258-288

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (FNTA_RAT | Q04631)

molecular function
	GO:0004662	CAAX-protein geranylgeranyltransferase activity	Catalysis of the reaction: geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. This reaction is the formation of a thioether linkage between the C-1 atom of the geranylgeranyl group and a cysteine residue fourth from the C-terminus of the protein. The protein substrates have the C-terminal sequence CA1A2X, where the terminal residue, X, is preferably leucine and A2 should not be aromatic. Known substrates include most g-subunits of heterotrimeric G proteins and Ras-related GTPases such as members of the Ras and Rac/Rho families.
	GO:0008144	drug binding	Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
	GO:0019840	isoprenoid binding	Interacting selectively and non-covalently with any isoprenoid compound, isoprene (2-methylbuta-1,3-diene) or compounds containing or derived from linked isoprene (3-methyl-2-butenylene) residues.
	GO:0042277	peptide binding	Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
	GO:0004659	prenyltransferase activity	Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004660	protein farnesyltransferase activity	Catalysis of the reaction: farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
	GO:0004661	protein geranylgeranyltransferase activity	Catalysis of the covalent addition of a geranylgeranyl (20-carbon isoprenoid) group via thioether linkages to a cysteine residue at or near the C terminus of a protein.
	GO:0008318	protein prenyltransferase activity	Catalysis of the covalent addition of an isoprenoid group such as a farnesyl or geranylgeranyl group via thioether linkages to a cysteine residue in a protein.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0051771	negative regulation of nitric-oxide synthase biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of a nitric-oxide synthase enzyme.
	GO:0045787	positive regulation of cell cycle	Any process that activates or increases the rate or extent of progression through the cell cycle.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of a nitric oxide synthase enzyme.
	GO:0018343	protein farnesylation	The covalent attachment of a farnesyl group to a protein.
	GO:0018344	protein geranylgeranylation	The covalent attachment of a geranylgeranyl group to a protein.
	GO:0018342	protein prenylation	The covalent attachment of a prenyl group to a protein; geranyl, farnesyl, or geranylgeranyl groups may be added.
	GO:0034097	response to cytokine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0010035	response to inorganic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an inorganic substance stimulus.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
cellular component
	GO:0005953	CAAX-protein geranylgeranyltransferase complex	A heterodimeric enzyme, composed of an alpha and a beta subunit. Participates in the post-translational C-terminal modification of several small GTPases, allowing their targeting to the membrane.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005965	protein farnesyltransferase complex	A protein complex that possesses protein farnesyltransferase activity.

Chain B (FNTB_RAT | Q02293)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0008144	drug binding	Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
	GO:0004311	farnesyltranstransferase activity	Catalysis of the reaction: 2-trans,6-trans-farnesyl diphosphate + isopentenyl diphosphate = diphosphate + geranylgeranyl diphosphate.
	GO:0019840	isoprenoid binding	Interacting selectively and non-covalently with any isoprenoid compound, isoprene (2-methylbuta-1,3-diene) or compounds containing or derived from linked isoprene (3-methyl-2-butenylene) residues.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0042277	peptide binding	Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
	GO:0004659	prenyltransferase activity	Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004660	protein farnesyltransferase activity	Catalysis of the reaction: farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0008285	negative regulation of cell proliferation	Any process that stops, prevents or reduces the rate or extent of cell proliferation.
	GO:0045787	positive regulation of cell cycle	Any process that activates or increases the rate or extent of progression through the cell cycle.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0048146	positive regulation of fibroblast proliferation	Any process that activates or increases the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
	GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of a nitric oxide synthase enzyme.
	GO:0018343	protein farnesylation	The covalent attachment of a farnesyl group to a protein.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:0034097	response to cytokine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
	GO:0010035	response to inorganic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an inorganic substance stimulus.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0042060	wound healing	The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
	GO:0005875	microtubule associated complex	Any multimeric complex connected to a microtubule.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0005965	protein farnesyltransferase complex	A protein complex that possesses protein farnesyltransferase activity.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		1NH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1o1s)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1o1s
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FNTA_RAT \| Q04631
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	FNTB_RAT \| Q02293
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	FNTA_RAT \| Q04631
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	FNTB_RAT \| Q02293
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1qbq	STRUCTURE OF THE SAME PROTEIN COMPLEXED WITH CVIM AND A FPP ANALOG

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 5)

Exons (12, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (2, 2)

Pfam Domains (3, 8)

Gene Ontology (34, 50)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File