Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  FARNESYLTRANSFERASE COMPLEX WITH TETRAHYDROPYRIDINE INHIBITORS
 
Authors :  S. L. Gwaltney Ii, S. J. O'Conner, L. T. Nelson, G. M. Sullivan, H. Imade, W. Wang, L. Hasvold, Q. Li, J. Cohen, W. Z. Gu
Date :  22 Nov 02  (Deposition) - 07 Jan 03  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Farnesyltransferase, Tetrahydropyridine, Prenyltransferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. L. Gwaltney Ii, S. J. O'Connor, L. T. Nelson, G. M. Sullivan, H. Imade, W. Wang, L. Hasvold, Q. Li, J. Cohen, W. Z. Gu, S. K. Tahir, J. Bauch, K. Marsh, S. C. Ng, D. J. Frost, H. Zhang, S. Muchmore, C. G. Jakob, V. Stoll, C. Hutchins, S. H. Rosenberg, H. L. Sham
Aryl Tetrahydropyridine Inhibitors Of Farnesyltransferase: Bioavailable Analogues With Improved Cellular Potency.
Bioorg. Med. Chem. Lett. V. 13 1363 2003
PubMed-ID: 12657283  |  Reference-DOI: 10.1016/S0960-894X(03)00094-5
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN FARNESYLTRANSFERASE ALPHA SUBUNIT
    ChainsA
    EC Number2.5.1.-
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System StrainSF9
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentRESIDUE 55-369
    Organism CommonNORWAY RAT
    Organism ScientificRATTUS NORVEGICUS
    Organism Taxid10116
    SynonymCAAX FARNESYLTRANSFERASE ALPHA SUBUNIT, RAS PROTEINS PRENYLTRANSFERASE ALPHA, FTASE-ALPHA
 
Molecule 2 - PROTEIN FARNESYLTRANSFERASE BETA SUBUNIT
    ChainsB
    EC Number2.5.1.-
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System CommonFALL ARMYWORM
    Expression System StrainSF9
    Expression System Taxid7108
    FragmentRESIDUE 22-423
    Organism CommonNORWAY RAT
    Organism ScientificRATTUS NORVEGICUS
    Organism Taxid10116
    SynonymCAAX FARNESYLTRANSFERASE BETA SUBUNIT, RAS PROTEINS PRENYLTRANSFERASE BETA, FTASE-BETA

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
1FTI1Ligand/Ion1-{2-[3-(4-CYANO-BENZYL)-3H-IMIDAZOL-4-YL]-ACETYL}-5-NAPHTHALEN-1-YL-1,2,3,6-TETRAHYDRO-PYRIDINE-4-CARBONITRILE
2HFP1Ligand/IonALPHA-HYDROXYFARNESYLPHOSPHONIC ACID
3ZN1Ligand/IonZINC ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREFTI B:1 , ASP B:297 , CYS B:299 , HIS B:362BINDING SITE FOR RESIDUE ZN B 500
2AC2SOFTWARELYS A:164 , TYR A:166 , TYR A:200 , FTI B:1 , TYR B:205 , HIS B:248 , GLY B:250 , TYR B:251 , ARG B:291 , TRP B:303 , TYR B:361BINDING SITE FOR RESIDUE HFP B 501
3AC3SOFTWARETYR A:166 , LEU B:96 , TRP B:106 , ASP B:359 , TYR B:361 , ZN B:500 , HFP B:501BINDING SITE FOR RESIDUE FTI B 1

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1N9A)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1N9A)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1N9A)

(-) PROSITE Motifs  (1, 5)

Asymmetric/Biological Unit (1, 5)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PFTAPS51147 Protein prenyltransferases alpha subunit repeat profile.FNTA_RAT112-146
147-181
215-249
182-214
255-289
  5A:112-146
A:147-181
A:215-249
A:182-214
A:255-289

(-) Exons   (12, 12)

Asymmetric/Biological Unit (12, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000105881ENSRNOE00000071243chr6:99427967-99428155189FNTB_RAT1-48481B:23-4826
1.2ENSRNOT000000105882ENSRNOE00000071421chr6:99447593-9944765765FNTB_RAT49-70221B:49-7022
1.3ENSRNOT000000105883ENSRNOE00000071602chr6:99457445-9945751773FNTB_RAT70-94251B:70-9425
1.4ENSRNOT000000105884ENSRNOE00000071771chr6:99459109-9945920092FNTB_RAT95-125311B:95-12531
1.5ENSRNOT000000105885ENSRNOE00000071976chr6:99471356-99471502147FNTB_RAT125-174501B:125-17450
1.6ENSRNOT000000105886ENSRNOE00000072148chr6:99471595-9947167884FNTB_RAT174-202291B:174-20229
1.7ENSRNOT000000105887ENSRNOE00000072321chr6:99480586-9948067287FNTB_RAT202-231301B:202-23130
1.8ENSRNOT000000105888ENSRNOE00000072507chr6:99489459-99489588130FNTB_RAT231-274441B:231-27444
1.9ENSRNOT000000105889ENSRNOE00000072695chr6:99492633-99492765133FNTB_RAT275-319451B:275-31945
1.10ENSRNOT0000001058810ENSRNOE00000072879chr6:99504658-99504769112FNTB_RAT319-356381B:319-35638
1.11ENSRNOT0000001058811ENSRNOE00000073070chr6:99505820-99505934115FNTB_RAT356-394391B:356-39439
1.12ENSRNOT0000001058812ENSRNOE00000238940chr6:99510015-995113731359FNTB_RAT395-437431B:395-42329

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:312
 aligned with FNTA_RAT | Q04631 from UniProtKB/Swiss-Prot  Length:377

    Alignment length:312
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364  
             FNTA_RAT    55 FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK 366
               SCOP domains d1n9aa_ A: Protein farnesyltransferase alpha-subunit                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 1n9aA00 A:55-366  [code=1.25.40.120, no name defined]                                                                                                                                                                                                                                                                    CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1n9aA01 A:258-288         ------------------------------------------------------------------------------ Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1n9aA02 A:258-288         ------------------------------------------------------------------------------ Pfam domains (2)
           Pfam domains (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1n9aA03 A:258-288         ------------------------------------------------------------------------------ Pfam domains (3)
           Pfam domains (4) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1n9aA04 A:258-288         ------------------------------------------------------------------------------ Pfam domains (4)
           Pfam domains (5) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PPTA-1n9aA05 A:258-288         ------------------------------------------------------------------------------ Pfam domains (5)
         Sec.struct. author ..................................ee..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhh....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ---------------------------------------------------------PFTA  PDB: A:112-146               PFTA  PDB: A:147-181               PFTA  PDB: A:182-214             PFTA  PDB: A:215-249               -----PFTA  PDB: A:255-289               ----------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1n9a A  55 FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK 366
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364  

Chain B from PDB  Type:PROTEIN  Length:401
 aligned with FNTB_RAT | Q02293 from UniProtKB/Swiss-Prot  Length:437

    Alignment length:401
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422 
             FNTB_RAT    23 LYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVMGVPENVLQPTHPVYNIGPDKVIQATTHFLQKPVPGF 423
               SCOP domains d1n9ab_ B: Protein farnesyltransferase, beta-subunit                                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 1n9aB00 B:23-423  [code=1.50.10.20, no name defined]                                                                                                                                                                                                                                                                                                                                                              CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------Prenyltrans_2-1n9aB03 B:127-241                                                                                    ----------------------------------------------------------------------------------------Prenyltrans-1n9aB01 B:330-374                ------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Prenyltrans-1n9aB02 B:330-374                ------------------------------------------------- Pfam domains (2)
         Sec.struct. author ......hhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh.eehhhhhhhh.hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhh.........hhhhhhhhh...............hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..................hhhhhh.hhhhhhhhhhhhh............hhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhh.............hhhhh..........hhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:23-48    Exon 1.2  PDB: B:49-70------------------------Exon 1.4  PDB: B:95-125        ------------------------------------------------Exon 1.6  PDB: B:174-202     ----------------------------Exon 1.8  PDB: B:231-274 UniProt: 231-274   --------------------------------------------Exon 1.10  PDB: B:319-356             --------------------------------------Exon 1.12  PDB: B:395-423     Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.3  PDB: B:70-94   ------------------------------Exon 1.5  PDB: B:125-174 UniProt: 125-174         ---------------------------Exon 1.7  PDB: B:202-231      -------------------------------------------Exon 1.9  PDB: B:275-319 UniProt: 275-319    ------------------------------------Exon 1.11  PDB: B:356-394              ----------------------------- Transcript 1 (2)
                 1n9a B  23 LYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPDGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYNVINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIGGVPGMEAHGGYTFCGLAALVILKKERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVMGVPENVLQPTHPVYNIGPDKVIQATTHFLQKPVPGF 423
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit

(-) Pfam Domains  (3, 8)

Asymmetric/Biological Unit
(-)
Clan: 6_Hairpin (120)
(-)
Family: PPTA (36)
3aPPTA-1n9aA01A:258-288
3bPPTA-1n9aA02A:258-288
3cPPTA-1n9aA03A:258-288
3dPPTA-1n9aA04A:258-288
3ePPTA-1n9aA05A:258-288

(-) Gene Ontology  (34, 50)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (FNTA_RAT | Q04631)
molecular function
    GO:0004662    CAAX-protein geranylgeranyltransferase activity    Catalysis of the reaction: geranylgeranyl diphosphate + protein-cysteine = S-geranylgeranyl-protein + diphosphate. This reaction is the formation of a thioether linkage between the C-1 atom of the geranylgeranyl group and a cysteine residue fourth from the C-terminus of the protein. The protein substrates have the C-terminal sequence CA1A2X, where the terminal residue, X, is preferably leucine and A2 should not be aromatic. Known substrates include most g-subunits of heterotrimeric G proteins and Ras-related GTPases such as members of the Ras and Rac/Rho families.
    GO:0008144    drug binding    Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
    GO:0019840    isoprenoid binding    Interacting selectively and non-covalently with any isoprenoid compound, isoprene (2-methylbuta-1,3-diene) or compounds containing or derived from linked isoprene (3-methyl-2-butenylene) residues.
    GO:0042277    peptide binding    Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
    GO:0004659    prenyltransferase activity    Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004660    protein farnesyltransferase activity    Catalysis of the reaction: farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
    GO:0004661    protein geranylgeranyltransferase activity    Catalysis of the covalent addition of a geranylgeranyl (20-carbon isoprenoid) group via thioether linkages to a cysteine residue at or near the C terminus of a protein.
    GO:0008318    protein prenyltransferase activity    Catalysis of the covalent addition of an isoprenoid group such as a farnesyl or geranylgeranyl group via thioether linkages to a cysteine residue in a protein.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0051771    negative regulation of nitric-oxide synthase biosynthetic process    Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of a nitric-oxide synthase enzyme.
    GO:0045787    positive regulation of cell cycle    Any process that activates or increases the rate or extent of progression through the cell cycle.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0051770    positive regulation of nitric-oxide synthase biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of a nitric oxide synthase enzyme.
    GO:0018343    protein farnesylation    The covalent attachment of a farnesyl group to a protein.
    GO:0018344    protein geranylgeranylation    The covalent attachment of a geranylgeranyl group to a protein.
    GO:0018342    protein prenylation    The covalent attachment of a prenyl group to a protein; geranyl, farnesyl, or geranylgeranyl groups may be added.
    GO:0034097    response to cytokine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
    GO:0010035    response to inorganic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an inorganic substance stimulus.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
cellular component
    GO:0005953    CAAX-protein geranylgeranyltransferase complex    A heterodimeric enzyme, composed of an alpha and a beta subunit. Participates in the post-translational C-terminal modification of several small GTPases, allowing their targeting to the membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005965    protein farnesyltransferase complex    A protein complex that possesses protein farnesyltransferase activity.

Chain B   (FNTB_RAT | Q02293)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0008144    drug binding    Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
    GO:0004311    farnesyltranstransferase activity    Catalysis of the reaction: 2-trans,6-trans-farnesyl diphosphate + isopentenyl diphosphate = diphosphate + geranylgeranyl diphosphate.
    GO:0019840    isoprenoid binding    Interacting selectively and non-covalently with any isoprenoid compound, isoprene (2-methylbuta-1,3-diene) or compounds containing or derived from linked isoprene (3-methyl-2-butenylene) residues.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0042277    peptide binding    Interacting selectively and non-covalently with peptides, any of a group of organic compounds comprising two or more amino acids linked by peptide bonds.
    GO:0004659    prenyltransferase activity    Catalysis of the transfer of a prenyl group from one compound (donor) to another (acceptor).
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004660    protein farnesyltransferase activity    Catalysis of the reaction: farnesyl diphosphate + protein-cysteine = S-farnesyl protein + diphosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0008285    negative regulation of cell proliferation    Any process that stops, prevents or reduces the rate or extent of cell proliferation.
    GO:0045787    positive regulation of cell cycle    Any process that activates or increases the rate or extent of progression through the cell cycle.
    GO:0008284    positive regulation of cell proliferation    Any process that activates or increases the rate or extent of cell proliferation.
    GO:0048146    positive regulation of fibroblast proliferation    Any process that activates or increases the frequency, rate or extent of multiplication or reproduction of fibroblast cells.
    GO:0051770    positive regulation of nitric-oxide synthase biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of a nitric oxide synthase enzyme.
    GO:0018343    protein farnesylation    The covalent attachment of a farnesyl group to a protein.
    GO:0042127    regulation of cell proliferation    Any process that modulates the frequency, rate or extent of cell proliferation.
    GO:0034097    response to cytokine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cytokine stimulus.
    GO:0010035    response to inorganic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an inorganic substance stimulus.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0042060    wound healing    The series of events that restore integrity to a damaged tissue, following an injury.
cellular component
    GO:0005875    microtubule associated complex    Any multimeric complex connected to a microtubule.
    GO:0043234    protein complex    A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
    GO:0005965    protein farnesyltransferase complex    A protein complex that possesses protein farnesyltransferase activity.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FTI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HFP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1n9a)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1n9a
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FNTA_RAT | Q04631
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  FNTB_RAT | Q02293
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.5.1.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FNTA_RAT | Q04631
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FNTB_RAT | Q02293
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FNTA_RAT | Q046311d8d 1d8e 1fpp 1ft1 1ft2 1fti 1hz7 1jcr 1jcs 1kzo 1kzp 1kzr 1n4p 1n4q 1n4r 1n4s 1n94 1n95 1ni1 1nl4 1o1r 1o1s 1o1t 1o5m 1qbq 1qe2 1s64 1sa5 1tn7 1tn8 1tnb 1tno 1tnu 1tny 1tnz 1x81 2bed 2fti 2r2l 2zir 2zis 3dpy 3e30 3e32 3e33 3e34 3eu5 3euv 3fti 3ksl 3ksq 3pz4 4gtm 4gto 4gtp 4gtq 4gtr
        FNTB_RAT | Q022931d8d 1d8e 1fpp 1ft1 1ft2 1fti 1hz7 1jcr 1jcs 1kzo 1kzp 1kzr 1n94 1n95 1ni1 1nl4 1o1r 1o1s 1o1t 1o5m 1qbq 1qe2 1sa5 1tn7 1tn8 1x81 2bed 2fti 2r2l 2zir 2zis 3dpy 3e30 3e32 3e33 3e34 3eu5 3euv 3fti 3ksl 3ksq 3pz4 4gtm 4gto 4gtp 4gtq 4gtr

(-) Related Entries Specified in the PDB File

1n94 1n95