1IK2 - JenaLib

Theor.Model - manually (Jmol Viewer)

Theoretical Model (Jmol Viewer)

Title :   HUMAN CARDIAC BETA-MYOSIN HEAVY CHAIN

Authors :   L. G. D'Cruz, G. M. Alter, J. Oberoi, F. D. Davison, W. J. Mckenna, N. D. Carter, C. Baboonian

Date :   01 May 01 (Deposition) - 01 Jul 03 (Release) - 01 Jul 03 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A

Keywords :   Cardiac Beta Myosin, Myosin Heavy Chain, Myosin Head, Subfragment-1, S1, Hypertrophic Cardiomyopathy, Cardiomyopathies, Beta Myosin, Sh1, Sh2, Reactive Cysteines, Atpase, Cys 695, Cys 705, Hcm, Heart, Sarcomere, Sudden Death, Dilated Cardiomyopathy, Cardiac Disease, Myh7, Myhc- Beta, Calmodulin Binding, Actin-Binding, Thick Filament, Muscle Protein, Disease Mutation, Multigene Family, Myosin, Human. (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. G. D'Cruz, G. M. Alter, W. J. Mckenna, N. D. Carter, C. Baboonian
Molecular Modelling And Mutation Mapping Of Human Cardiac Beta-Myosin Heavy Chain
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - BETA MYOSIN HEAVY CHAIN
	Chains	:	A
	Fragment	:	CARDIAC ISOFORM OF HUMAN BETA MYOSIN HEAVY CHAIN
	Organ	:	HEART
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1IK2)

(no "Site" information available for 1IK2)

(no "SS Bond" information available for 1IK2)

Theoretical Model

No.	Residues
1	Gly A:634	-	Lys A:635
2	Lys A:637	-	Ala A:638

Theoretical Model (135, 135)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
001	UniProt	VAR_029430	D	3	A	MYH7_HUMAN	Polymorphism	3729993	A	D	3	A
002	UniProt	VAR_004566	A	26	V	MYH7_HUMAN	Disease (CMH1)	186964570	A	A	26	V
003	UniProt	VAR_019845	V	39	M	MYH7_HUMAN	Disease (CMH1)	376160714	A	V	39	M
004	UniProt	VAR_004567	V	59	I	MYH7_HUMAN	Disease (CMH1)	771132107	A	V	59	I
005	UniProt	VAR_017745	D	107	E	MYH7_HUMAN	Polymorphism	2754166	A	D	107	E
006	UniProt	VAR_042762	Y	115	H	MYH7_HUMAN	Disease (CMH1)	397516183	A	Y	115	H
007	UniProt	VAR_020797	T	124	I	MYH7_HUMAN	Disease (CMH1)	---	A	T	124	I
008	UniProt	VAR_042763	R	143	G	MYH7_HUMAN	Disease (CMH1)	727503278	A	R	143	G
009	UniProt	VAR_004568	R	143	Q	MYH7_HUMAN	Disease (CMH1)	397516209	A	R	143	Q
010	UniProt	VAR_029431	R	143	W	MYH7_HUMAN	Disease (CMH1)	727503278	A	R	143	W
011	UniProt	VAR_042764	K	146	N	MYH7_HUMAN	Disease (CMH1)	397516212	A	K	146	N
012	UniProt	VAR_042765	S	148	I	MYH7_HUMAN	Disease (CMH1)	772691929	A	S	148	I
013	UniProt	VAR_020798	Y	162	C	MYH7_HUMAN	Disease (CMH1)	---	A	Y	162	C
014	UniProt	VAR_042766	V	186	L	MYH7_HUMAN	Disease (CMH1)	786205906	A	V	186	L
015	UniProt	VAR_020799	N	187	K	MYH7_HUMAN	Disease (CMH1)	---	A	N	187	K
016	UniProt	VAR_019846	T	188	N	MYH7_HUMAN	Disease (CMH1)	730880844	A	T	188	N
017	UniProt	VAR_020800	R	190	T	MYH7_HUMAN	Disease (CMH1)	---	A	R	190	T
018	UniProt	VAR_042767	A	196	T	MYH7_HUMAN	Disease (CMH1)	---	A	A	196	T
019	UniProt	VAR_042768	I	201	T	MYH7_HUMAN	Disease (CMD1S)	397516258	A	I	201	T
020	UniProt	VAR_019847	R	204	H	MYH7_HUMAN	Disease (CMH1)	397516260	A	R	204	H
021	UniProt	VAR_042769	K	207	Q	MYH7_HUMAN	Disease (CMH1)	727504273	A	K	207	Q
022	UniProt	VAR_042770	P	211	L	MYH7_HUMAN	Disease (CMH1)	727503277	A	P	211	L
023	UniProt	VAR_020801	Q	222	K	MYH7_HUMAN	Disease (CMH1)	---	A	Q	222	K
024	UniProt	VAR_017746	A	223	T	MYH7_HUMAN	Disease (CMD1S)	121913645	A	A	223	T
025	UniProt	VAR_042771	L	227	V	MYH7_HUMAN	Disease (CMH1)	---	A	L	227	V
026	UniProt	VAR_019848	N	232	S	MYH7_HUMAN	Disease (CMH1)	---	A	N	232	S
027	UniProt	VAR_073876	R	243	H	MYH7_HUMAN	Disease (CMH1)	267606910	A	R	243	H
028	UniProt	VAR_020802	F	244	L	MYH7_HUMAN	Disease (CMH1)	730880849	A	F	244	L
029	UniProt	VAR_004569	R	249	Q	MYH7_HUMAN	Disease (CMH1)	3218713	A	R	249	Q
030	UniProt	VAR_004570	G	256	E	MYH7_HUMAN	Disease (CMH1)	121913633	A	G	256	E
031	UniProt	VAR_042772	I	263	M	MYH7_HUMAN	Disease (CMH1)	730880855	A	I	263	M
032	UniProt	VAR_004571	I	263	T	MYH7_HUMAN	Disease (CMH1)	397516269	A	I	263	T
033	UniProt	VAR_073877	Y	283	D	MYH7_HUMAN	Disease (CMD1S)	397515482	A	Y	283	D
034	UniProt	VAR_042773	F	312	C	MYH7_HUMAN	Disease (CMH1)	---	A	F	312	C
035	UniProt	VAR_020803	V	320	M	MYH7_HUMAN	Disease (CMH1)	376897125	A	V	320	M
036	UniProt	VAR_042774	E	328	G	MYH7_HUMAN	Disease (CMH1)	---	A	E	328	G
037	UniProt	VAR_004572	M	349	T	MYH7_HUMAN	Disease (CMH1)	121913640	A	M	349	T
038	UniProt	VAR_073878	Y	350	N	MYH7_HUMAN	Disease (CMD1S)	---	A	Y	350	N
039	UniProt	VAR_042775	K	351	E	MYH7_HUMAN	Disease (CMH1)	730880864	A	K	351	E
040	UniProt	VAR_019849	A	355	T	MYH7_HUMAN	Disease (CMH1)	397516088	A	A	355	T
041	UniProt	VAR_042776	K	383	N	MYH7_HUMAN	Disease (CMH1)	---	A	K	383	N
042	UniProt	VAR_042777	A	385	V	MYH7_HUMAN	Disease (CMH1)	---	A	A	385	V
043	UniProt	VAR_073879	L	390	P	MYH7_HUMAN	Disease (CMD1S)	---	A	L	390	P
044	UniProt	VAR_020804	L	390	V	MYH7_HUMAN	Disease (CMH1)	---	A	L	390	V
045	UniProt	VAR_004573	R	403	L	MYH7_HUMAN	Disease (CMH1)	121913624	A	R	403	L
046	UniProt	VAR_004574	R	403	Q	MYH7_HUMAN	Disease (CMH1)	121913624	A	R	403	Q
047	UniProt	VAR_004575	R	403	W	MYH7_HUMAN	Disease (CMH1)	3218714	A	R	403	W
048	UniProt	VAR_042778	V	404	L	MYH7_HUMAN	Disease (CMH1)	---	A	V	404	L
049	UniProt	VAR_042779	V	404	M	MYH7_HUMAN	Disease (CMH1)	730880867	A	V	404	M
050	UniProt	VAR_020805	V	406	M	MYH7_HUMAN	Disease (CMH1)	---	A	V	406	M
051	UniProt	VAR_042780	G	407	V	MYH7_HUMAN	Disease (CMH1)	397516095	A	G	407	V
052	UniProt	VAR_029432	V	411	I	MYH7_HUMAN	Disease (CMH1)	730880868	A	V	411	I
053	UniProt	VAR_042781	T	412	N	MYH7_HUMAN	Disease (CMD1S)	---	A	T	412	N
054	UniProt	VAR_042782	G	425	R	MYH7_HUMAN	Disease (CMH1)	397516097	A	G	425	R
055	UniProt	VAR_019850	A	428	V	MYH7_HUMAN	Disease (CMH1)	727503266	A	A	428	V
056	UniProt	VAR_029433	A	430	E	MYH7_HUMAN	Disease (CMH1)	---	A	A	430	E
057	UniProt	VAR_042783	M	435	T	MYH7_HUMAN	Disease (CMH1)	---	A	M	435	T
058	UniProt	VAR_042784	V	440	M	MYH7_HUMAN	Disease (CMH1)	397516098	A	V	440	M
059	UniProt	VAR_042785	T	441	M	MYH7_HUMAN	Disease (MPD1)	121913653	A	T	441	M
060	UniProt	VAR_019851	I	443	T	MYH7_HUMAN	Disease (CMH1)	---	A	I	443	T
061	UniProt	VAR_042786	K	450	E	MYH7_HUMAN	Disease (CMH1)	---	A	K	450	E
062	UniProt	VAR_042787	K	450	T	MYH7_HUMAN	Disease (CMH1)	---	A	K	450	T
063	UniProt	VAR_004576	R	453	C	MYH7_HUMAN	Disease (CMH1)	121913625	A	R	453	C
064	UniProt	VAR_042788	R	453	H	MYH7_HUMAN	Disease (CMH1)	397516101	A	R	453	H
065	UniProt	VAR_073880	R	453	S	MYH7_HUMAN	Disease (CMH1)	121913625	A	R	453	S
066	UniProt	VAR_029434	E	466	Q	MYH7_HUMAN	Polymorphism	4981473	A	E	466	Q
067	UniProt	VAR_019852	N	479	S	MYH7_HUMAN	Disease (CMH1)	727504236	A	N	479	S
068	UniProt	VAR_019853	E	483	K	MYH7_HUMAN	Disease (CMH1)	121913651	A	E	483	K
069	UniProt	VAR_073881	E	497	D	MYH7_HUMAN	Disease (CMH1)	267606911	A	E	497	D
070	UniProt	VAR_020806	E	499	K	MYH7_HUMAN	Disease (CMH1)	3218715	A	E	499	K
071	UniProt	VAR_042789	E	500	A	MYH7_HUMAN	Disease (CMH1)	727504286	A	E	500	A
072	UniProt	VAR_042790	Y	501	C	MYH7_HUMAN	Disease (CMH1)	---	A	Y	501	C
073	UniProt	VAR_042791	I	511	F	MYH7_HUMAN	Disease (CMH1)	---	A	I	511	F
074	UniProt	VAR_042792	I	511	T	MYH7_HUMAN	Disease (CMH1)	397516110	A	I	511	T
075	UniProt	VAR_004577	F	513	C	MYH7_HUMAN	Disease (CMH1)	121913636	A	F	513	C
076	UniProt	VAR_042793	M	515	R	MYH7_HUMAN	Disease (CMH1)	---	A	M	515	R
077	UniProt	VAR_039562	M	515	V	MYH7_HUMAN	Disease (CMH1)	---	A	M	515	V
078	UniProt	VAR_029435	L	517	M	MYH7_HUMAN	Disease (CMH1)	727504237	A	L	517	M
079	UniProt	VAR_017747	S	532	P	MYH7_HUMAN	Disease (CMD1S)	121913642	A	S	532	P
080	UniProt	VAR_042794	A	550	V	MYH7_HUMAN	Disease (CMD1S)	---	A	A	550	V
081	UniProt	VAR_042795	G	571	R	MYH7_HUMAN	Disease (CMH1)	730880879	A	G	571	R
082	UniProt	VAR_042796	H	576	R	MYH7_HUMAN	Disease (CMH1)	727504238	A	H	576	R
083	UniProt	VAR_004578	G	584	R	MYH7_HUMAN	Disease (CMH1)	121913626	A	G	584	R
084	UniProt	VAR_029436	G	584	S	MYH7_HUMAN	Disease (CMH1)	121913626	A	G	584	S
085	UniProt	VAR_004579	D	587	V	MYH7_HUMAN	Disease (CMH1)	---	A	D	587	V
086	UniProt	VAR_020807	Q	595	R	MYH7_HUMAN	Disease (CMH1)	---	A	Q	595	R
087	UniProt	VAR_020808	L	601	V	MYH7_HUMAN	Disease (CMH1)	---	A	L	601	V
088	UniProt	VAR_004580	N	602	S	MYH7_HUMAN	Disease (CMH1)	730880880	A	N	602	S
089	UniProt	VAR_004581	V	606	M	MYH7_HUMAN	Disease (CMH1)	121913627	A	V	606	M
090	UniProt	VAR_004582	K	615	N	MYH7_HUMAN	Disease (CMH1)	---	A	K	615	N
091	UniProt	VAR_042797	K	615	Q	MYH7_HUMAN	Disease (CMH1)	---	A	K	615	Q
092	UniProt	VAR_017748	S	642	L	MYH7_HUMAN	Disease (CMD1S)	121913646	A	S	642	L
093	UniProt	VAR_019854	M	659	I	MYH7_HUMAN	Disease (CMH1)	---	A	M	659	I
094	UniProt	VAR_042798	R	663	C	MYH7_HUMAN	Disease (CMH1)	397516127	A	R	663	C
095	UniProt	VAR_019855	R	663	H	MYH7_HUMAN	Disease (CMH1)	371898076	A	R	663	H
096	UniProt	VAR_019856	R	663	S	MYH7_HUMAN	Disease (CMH1)	---	A	R	663	S
097	UniProt	VAR_019857	R	671	C	MYH7_HUMAN	Disease (CMH1)	727503263	A	R	671	C
098	UniProt	VAR_020809	R	694	C	MYH7_HUMAN	Disease (CMH1)	727504240	A	R	694	C
099	UniProt	VAR_029437	R	694	H	MYH7_HUMAN	Disease (CMH1)	---	A	R	694	H
100	UniProt	VAR_020810	N	696	S	MYH7_HUMAN	Disease (CMH1)	730880732	A	N	696	S
101	UniProt	VAR_042799	V	698	A	MYH7_HUMAN	Disease (CMH1)	397516130	A	V	698	A
102	UniProt	VAR_020811	R	712	L	MYH7_HUMAN	Disease (CMH1)	---	A	R	712	L
103	UniProt	VAR_004583	G	716	R	MYH7_HUMAN	Disease (CMH1)	121913638	A	G	716	R
104	UniProt	VAR_017749	R	719	Q	MYH7_HUMAN	Disease (CMH1)	121913641	A	R	719	Q
105	UniProt	VAR_004584	R	719	W	MYH7_HUMAN	Disease (CMH1)	121913637	A	R	719	W
106	UniProt	VAR_004585	R	723	C	MYH7_HUMAN	Disease (CMH1)	121913630	A	R	723	C
107	UniProt	VAR_020812	R	723	G	MYH7_HUMAN	Disease (CMH1)	121913630	A	R	723	G
108	UniProt	VAR_017750	A	728	V	MYH7_HUMAN	Disease (CMH1)	121913644	A	A	728	V
109	UniProt	VAR_004586	P	731	L	MYH7_HUMAN	Disease (CMH1)	---	A	P	731	L
110	UniProt	VAR_019858	G	733	E	MYH7_HUMAN	Disease (CMH1)	727504241	A	G	733	E
111	UniProt	VAR_029438	Q	734	E	MYH7_HUMAN	Disease (CMH1)	---	A	Q	734	E
112	UniProt	VAR_042800	Q	734	P	MYH7_HUMAN	Disease (CMH1)	863225097	A	Q	734	P
113	UniProt	VAR_004587	I	736	M	MYH7_HUMAN	Disease (CMH1)	---	A	I	736	M
114	UniProt	VAR_029439	I	736	T	MYH7_HUMAN	Disease (CMH1)	727503261	A	I	736	T
115	UniProt	VAR_004588	G	741	R	MYH7_HUMAN	Disease (CMH1)	121913632	A	G	741	R
116	UniProt	VAR_004589	G	741	W	MYH7_HUMAN	Disease (CMH1)	121913632	A	G	741	W
117	UniProt	VAR_042801	A	742	E	MYH7_HUMAN	Disease (CMH1)	786205907	A	A	742	E
118	UniProt	VAR_014199	E	743	D	MYH7_HUMAN	Disease (CMH1)	397516139	A	E	743	D
119	UniProt	VAR_042802	V	763	G	MYH7_HUMAN	Disease (CMH1)	730880735	A	V	763	G
120	UniProt	VAR_045926	V	763	M	MYH7_HUMAN	Disease (CMH1)	727504253	A	V	763	M
121	UniProt	VAR_017751	F	764	L	MYH7_HUMAN	Disease (CMD1S)	121913643	A	F	764	L
122	UniProt	VAR_019859	G	768	R	MYH7_HUMAN	Disease (CMH1)	727503260	A	G	768	R
123	UniProt	VAR_042803	E	774	V	MYH7_HUMAN	Disease (CMH1)	---	A	E	774	V
124	UniProt	VAR_019860	D	778	E	MYH7_HUMAN	Disease (CMH1)	2069544	A	D	778	E
125	UniProt	VAR_004590	D	778	G	MYH7_HUMAN	Disease (CMH1)	121913634	A	D	778	G
126	UniProt	VAR_042804	D	778	V	MYH7_HUMAN	Disease (CMH1)	---	A	D	778	V
127	UniProt	VAR_020813	S	782	N	MYH7_HUMAN	Disease (CMH1)	---	A	S	782	N
128	UniProt	VAR_045927	R	787	C	MYH7_HUMAN	Disease (CMH1)	145677314	A	R	787	C
129	UniProt	VAR_019861	R	787	H	MYH7_HUMAN	Disease (CMH1)	376754645	A	R	787	H
130	UniProt	VAR_029440	L	796	F	MYH7_HUMAN	Disease (CMH1)	---	A	L	796	F
131	UniProt	VAR_004591	A	797	T	MYH7_HUMAN	Disease (CMH1)	3218716	A	A	797	T
132	UniProt	VAR_042805	M	822	L	MYH7_HUMAN	Disease (CMH1)	730880742	A	M	822	L
133	UniProt	VAR_042806	M	822	T	MYH7_HUMAN	Disease (CMH1)	---	A	M	822	T
134	UniProt	VAR_042807	G	823	E	MYH7_HUMAN	Disease (CMH1)	---	A	G	823	E
135	UniProt	VAR_029441	V	824	I	MYH7_HUMAN	Disease (CMH1)	---	A	V	824	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Theoretical Model (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MYOSIN_MOTOR	PS51456	Myosin motor domain profile.	MYH7_HUMAN	85-778	1	A:85-778
2	IQ	PS50096	IQ motif profile.	MYH7_HUMAN	781-810	1	A:781-810

Theoretical Model (20, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000355349	1b	ENSE00001333122	chr14:23904870-23904829	42	MYH7_HUMAN	-	0	0	-	-
1.2b	ENST00000355349	2b	ENSE00001333121	chr14:23903458-23903403	56	MYH7_HUMAN	-	0	0	-	-
1.3	ENST00000355349	3	ENSE00002141330	chr14:23902949-23902741	209	MYH7_HUMAN	1-67	67	1	A:1-67	67
1.4	ENST00000355349	4	ENSE00000654043	chr14:23902436-23902293	144	MYH7_HUMAN	68-115	48	1	A:68-115	48
1.5	ENST00000355349	5	ENSE00001647421	chr14:23902004-23901848	157	MYH7_HUMAN	116-168	53	1	A:116-168	53
1.6	ENST00000355349	6	ENSE00000654040	chr14:23901715-23901688	28	MYH7_HUMAN	168-177	10	1	A:168-177	10
1.7	ENST00000355349	7	ENSE00000654039	chr14:23901078-23900970	109	MYH7_HUMAN	177-213	37	1	A:177-213	37
1.8	ENST00000355349	8	ENSE00001805709	chr14:23900886-23900794	93	MYH7_HUMAN	214-244	31	1	A:214-244	31
1.9	ENST00000355349	9	ENSE00001610903	chr14:23900690-23900627	64	MYH7_HUMAN	245-266	22	1	A:245-266	22
1.10	ENST00000355349	10	ENSE00001797612	chr14:23900208-23900110	99	MYH7_HUMAN	266-299	34	1	A:266-299	34
1.11	ENST00000355349	11	ENSE00000654035	chr14:23899872-23899769	104	MYH7_HUMAN	299-333	35	1	A:299-333	35
1.12	ENST00000355349	12	ENSE00001802826	chr14:23899122-23898984	139	MYH7_HUMAN	334-380	47	1	A:334-380	47
1.13	ENST00000355349	13	ENSE00000654032	chr14:23898556-23898438	119	MYH7_HUMAN	380-419	40	1	A:380-419	40
1.14	ENST00000355349	14	ENSE00000654031	chr14:23898313-23898164	150	MYH7_HUMAN	420-469	50	1	A:420-469	50
1.15	ENST00000355349	15	ENSE00001747242	chr14:23897879-23897709	171	MYH7_HUMAN	470-526	57	1	A:470-526	57
1.16	ENST00000355349	16	ENSE00000654029	chr14:23897103-23896794	310	MYH7_HUMAN	527-630	104	1	A:527-630	104
1.17	ENST00000355349	17	ENSE00000654028	chr14:23896516-23896449	68	MYH7_HUMAN	630-652	23	1	A:630-652	23
1.18	ENST00000355349	18	ENSE00001797702	chr14:23896073-23895986	88	MYH7_HUMAN	653-682	30	1	A:653-682	30
1.19	ENST00000355349	19	ENSE00001643045	chr14:23895290-23895173	118	MYH7_HUMAN	682-721	40	1	A:682-721	40
1.20	ENST00000355349	20	ENSE00001618128	chr14:23895027-23894904	124	MYH7_HUMAN	721-762	42	1	A:721-762	42
1.21	ENST00000355349	21	ENSE00000654023	chr14:23894627-23894491	137	MYH7_HUMAN	763-808	46	1	A:763-808	46
1.22	ENST00000355349	22	ENSE00000654022	chr14:23894233-23893978	256	MYH7_HUMAN	808-893	86	1	A:808-841	34
1.23	ENST00000355349	23	ENSE00001625387	chr14:23893358-23893116	243	MYH7_HUMAN	894-974	81	0	-	-
1.24	ENST00000355349	24	ENSE00001636102	chr14:23892932-23892756	177	MYH7_HUMAN	975-1033	59	0	-	-
1.25	ENST00000355349	25	ENSE00001767436	chr14:23891534-23891389	146	MYH7_HUMAN	1034-1082	49	0	-	-
1.26	ENST00000355349	26	ENSE00000586050	chr14:23890257-23890167	91	MYH7_HUMAN	1082-1112	31	0	-	-
1.27	ENST00000355349	27	ENSE00001776760	chr14:23889443-23889054	390	MYH7_HUMAN	1113-1242	130	0	-	-
1.28	ENST00000355349	28	ENSE00000654015	chr14:23888818-23888692	127	MYH7_HUMAN	1243-1285	43	0	-	-
1.29	ENST00000355349	29	ENSE00001711774	chr14:23888504-23888386	119	MYH7_HUMAN	1285-1324	40	0	-	-
1.30	ENST00000355349	30	ENSE00001661625	chr14:23887615-23887419	197	MYH7_HUMAN	1325-1390	66	0	-	-
1.31	ENST00000355349	31	ENSE00000654012	chr14:23886895-23886712	184	MYH7_HUMAN	1390-1451	62	0	-	-
1.32	ENST00000355349	32	ENSE00001720186	chr14:23886527-23886362	166	MYH7_HUMAN	1452-1507	56	0	-	-
1.33	ENST00000355349	33	ENSE00000654010	chr14:23886201-23886077	125	MYH7_HUMAN	1507-1548	42	0	-	-
1.34	ENST00000355349	34	ENSE00001701082	chr14:23885521-23885213	309	MYH7_HUMAN	1549-1651	103	0	-	-
1.35	ENST00000355349	35	ENSE00001690609	chr14:23885041-23884838	204	MYH7_HUMAN	1652-1719	68	0	-	-
1.36	ENST00000355349	36	ENSE00001766234	chr14:23884715-23884590	126	MYH7_HUMAN	1720-1761	42	0	-	-
1.37	ENST00000355349	37	ENSE00001758206	chr14:23884479-23884204	276	MYH7_HUMAN	1762-1853	92	0	-	-
1.38	ENST00000355349	38	ENSE00001617095	chr14:23883311-23883216	96	MYH7_HUMAN	1854-1885	32	0	-	-
1.39	ENST00000355349	39	ENSE00001666341	chr14:23883102-23882968	135	MYH7_HUMAN	1886-1930	45	0	-	-
1.40a	ENST00000355349	40a	ENSE00001527594	chr14:23882080-23881950	131	MYH7_HUMAN	1931-1935	5	0	-	-

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:841
 aligned with MYH7_HUMAN | P12883 from UniProtKB/Swiss-Prot  Length:1935

    Alignment length:841
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840 
           MYH7_HUMAN     1 MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGLFCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDPLNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLLK 841
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhh..........hhhhhh........................................................................................eeee..eeeee.........hhhhhhhh...........hhhhhhhhhhhhhh....eeeeeee.hhhhhhhhh..hhhhhhhhh..............hhhhhhhhhhhhhhhhhhh...................................................hhhhhhhh...hhhhhhh........hhhhh.........hhhhhhhhhhhhhhhhhh..........hhhhhh.....................hhhhhhh.....hhhhhhhhhhh.ee......ee...hhhhhhhhhhh.......hhhhhhhhhhhhhh.........eeee...........hhhhhhhhhhh....hhhhhhhhhhhhhh...........hhhhhhhhhhhh............................hhhhhh.....ee.............eeee..eee................hhhhhhhhh..................................hhhhhhhhhh.............eeeee...........hhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhh................hhhhhhh.....................hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.................. Sec.struct. author
             SAPs(SNPs) (1) --A----------------------V------------M-------------------I-----------------------------------------------E-------H--------I------------------G--N-I-------------C-----------------------LKN-T-----T----T--H--Q---L----------KT---V----S----------HL----Q------E------M-------------------D----------------------------C-------M-------G--------------------TNE---T---------------------------N-V----P------------LL-MV---IN------------R--V-E----T----MM-T------E--C------------Q------------S---K-------------D-KAC---------F-C-R-M--------------P-----------------V--------------------R----R-------R--V-------R-----VS---M--------N--------------------------L----------------I---C-------C----------------------C-S-A-------------L---R--Q---C----V--L-EE-M----RED-------------------GL---R-----V---E---N----C--------FT------------------------LEI----------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------------------------------------Q-----------------------------------------------------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------------------------V------------QM---------------------------------------------T--H---------------------------------------------------------T---V--------------------------------------------------------------------S------------------------------Q-----------------------------------------------H------------------------------H------------------------W---G----------P-T----W---------------------M--------------G--------H----------------------------------T------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------------------------------------------------------------------------------------------------W-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------W-------------------------------------------------S-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------S------------------------------------------------------------------------------------------------------------------V--------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ------------------------------------------------------------------------------------MYOSIN_MOTOR  PDB: A:85-778 UniProt: 85-778                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                           --IQ  PDB: A:781-810            ------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:1-67 UniProt: 1-67                                Exon 1.4  PDB: A:68-115 UniProt: 68-115         Exon 1.5  PDB: A:116-168 UniProt: 116-168            --------Exon 1.7  PDB: A:177-213             Exon 1.8  PDB: A:214-244       ---------------------Exon 1.10  PDB: A:266-299         ----------------------------------Exon 1.12  PDB: A:334-380 UniProt: 334-380     ---------------------------------------Exon 1.14  PDB: A:420-469 UniProt: 420-469        Exon 1.15  PDB: A:470-526 UniProt: 470-526               Exon 1.16  PDB: A:527-630 UniProt: 527-630                                                              ----------------------Exon 1.18  PDB: A:653-682     --------------------------------------Exon 1.20  PDB: A:721-762 UniProt: 721-762Exon 1.21  PDB: A:763-808 UniProt: 763-808    --------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.6  -------------------------------------------------------------------Exon 1.9              --------------------------------Exon 1.11  PDB: A:299-333          ----------------------------------------------Exon 1.13  PDB: A:380-419               ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.17              -----------------------------Exon 1.19  PDB: A:682-721               --------------------------------------------------------------------------------------Exon 1.22  PDB: A:808-841          Transcript 1 (2)
                 1ik2 A   1 MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGLFCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDPLNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLLK 841
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       780       790       800       810       820       830       840

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1IK2)

(no "CATH Domain" information available for 1IK2)

(no "Pfam Domain" information available for 1IK2)

Theoretical Model(hide GO term definitions)

Chain A (MYH7_HUMAN | P12883)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0030898	actin-dependent ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate. This reaction requires the presence of an actin filament to accelerate release of ADP and phosphate.
	GO:0005516	calmodulin binding	Interacting selectively and non-covalently with calmodulin, a calcium-binding protein with many roles, both in the calcium-bound and calcium-free states.
	GO:0000146	microfilament motor activity	Catalysis of movement along a microfilament, coupled to the hydrolysis of a nucleoside triphosphate (usually ATP).
	GO:0003774	motor activity	Catalysis of the generation of force resulting either in movement along a microfilament or microtubule, or in torque resulting in membrane scission, coupled to the hydrolysis of a nucleoside triphosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0046034	ATP metabolic process	The chemical reactions and pathways involving ATP, adenosine triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0007512	adult heart development	The process whose specific outcome is the progression of the adult heart over time, from its formation to the mature structure.
	GO:0060048	cardiac muscle contraction	Muscle contraction of cardiac muscle tissue.
	GO:0006936	muscle contraction	A process in which force is generated within muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis.
	GO:0030049	muscle filament sliding	The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
	GO:0002027	regulation of heart rate	Any process that modulates the frequency or rate of heart contraction.
	GO:0031449	regulation of slow-twitch skeletal muscle fiber contraction	Any process that modulates the frequency, rate or extent of slow-twitch skeletal muscle contraction.
	GO:0002026	regulation of the force of heart contraction	Any process that modulates the extent of heart contraction, changing the force with which blood is propelled.
	GO:0014728	regulation of the force of skeletal muscle contraction	Any process that modulates the frequency, rate or extent of the force of skeletal muscle contraction. The force of skeletal muscle contraction is produced by acto-myosin interaction processes through the formation of cross bridges.
	GO:0003009	skeletal muscle contraction	A process in which force is generated within skeletal muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. In the skeletal muscle, the muscle contraction takes advantage of an ordered sarcomeric structure and in most cases it is under voluntary control.
	GO:0006941	striated muscle contraction	A process in which force is generated within striated muscle tissue, resulting in the shortening of the muscle. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. Striated muscle is a type of muscle in which the repeating units (sarcomeres) of the contractile myofibrils are arranged in registry throughout the cell, resulting in transverse or oblique striations observable at the level of the light microscope.
	GO:0014883	transition between fast and slow fiber	The process of conversion of fast-contracting muscle fibers to a slower character. This may involve slowing of contractile rate, slow myosin gene induction, increase in oxidative metabolic properties, altered electrophysiology and altered innervation. This process also regulates skeletal muscle adapatation.
	GO:0055010	ventricular cardiac muscle tissue morphogenesis	The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
	GO:0030018	Z disc	Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005859	muscle myosin complex	A filament of myosin found in a muscle cell of any type.
	GO:0030016	myofibril	The contractile element of skeletal and cardiac muscle; a long, highly organized bundle of actin, myosin, and other proteins that contracts by a sliding filament mechanism.
	GO:0016459	myosin complex	A protein complex, formed of one or more myosin heavy chains plus associated light chains and other proteins, that functions as a molecular motor; uses the energy of ATP hydrolysis to move actin filaments or to move vesicles or other cargo on fixed actin filaments; has magnesium-ATPase activity and binds actin. Myosin classes are distinguished based on sequence features of the motor, or head, domain, but also have distinct tail regions that are believed to bind specific cargoes.
	GO:0032982	myosin filament	A protein complex containing myosin heavy chains, plus associated light chains and other proteins, in which the myosin heavy chains are arranged into a filament.
	GO:0030017	sarcomere	The repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.
	GO:0001725	stress fiber	A contractile actin filament bundle that consists of short actin filaments with alternating polarity, cross-linked by alpha-actinin and possibly other actin bundling proteins, and with myosin present in a periodic distribution along the fiber.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ik2)

	Sites
(no "Sites" information available for 1ik2)

	Cis Peptide Bonds
		Gly A:634 - Lys A:635	[ RasMol ]
		Lys A:637 - Ala A:638	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ik2
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MYH7_HUMAN \| P12883
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	160500
		Disease Information	:	OMIM
	192600
		Disease Information	:	OMIM
	613426
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MYH7_HUMAN \| P12883
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1IK2)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (135, 135)

PROSITE Motifs (2, 2)

Exons (20, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (32, 32)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File