Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF GLUCOSE-FRUCTOSE OXIDOREDUCTASE (GFOR) DELTA1-22 S64D
 
Authors :  J. S. Lott, D. Halbig, H. M. Baker, M. J. Hardman, G. A. Sprenger, E. N. Baker
Date :  20 Apr 00  (Deposition) - 04 Dec 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Nadp/Nad Binding, Osmotic Protection, Periplasm, Oligomerization State, N-Terminal Arm, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. S. Lott, D. Halbig, H. M. Baker, M. J. Hardman, G. A. Sprenger, E. N. Baker
Crystal Structure Of A Truncated Mutant Of Glucose-Fructose Oxidoreductase Shows That An N-Terminal Arm Controls Tetramer Formation.
J. Mol. Biol. V. 304 575 2000
PubMed-ID: 11099381  |  Reference-DOI: 10.1006/JMBI.2000.4245
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - GLUCOSE-FRUCTOSE OXIDOREDUCTASE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ZYMOMONAS MOBILIS
    Expression System Plasmid: PZY470
    Expression System Taxid: 542
    Expression System Vector Type: PLASMID
    Mutation: YES
    Organism Scientific: ZYMOMONAS MOBILIS
    Organism Taxid: 542
    Synonym: GFOR

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1NAD4Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 2 (1, 2)
No.NameCountTypeFull Name
1NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:38 , LEU A:39 , GLY A:40 , LYS A:41 , TYR A:42 , ASP A:64 , TYR A:87 , ILE A:105 , LEU A:106 , PRO A:107 , ASN A:108 , HIS A:111 , GLU A:128 , LYS A:129 , ARG A:157 , TRP A:199 , ARG A:200 , TYR A:217 , TYR A:296 , HOH A:605 , HOH A:647 , HOH A:656 , HOH A:657BINDING SITE FOR RESIDUE NAD A 500
2AC2SOFTWAREGLY B:38 , LEU B:39 , GLY B:40 , LYS B:41 , TYR B:42 , ASP B:64 , TYR B:87 , ILE B:105 , LEU B:106 , PRO B:107 , ASN B:108 , HIS B:111 , GLU B:128 , LYS B:129 , ARG B:157 , TRP B:199 , ARG B:200 , TYR B:217 , TYR B:296 , HOH B:600 , HOH B:638 , HOH B:675BINDING SITE FOR RESIDUE NAD B 501
3AC3SOFTWAREGLY C:38 , LEU C:39 , GLY C:40 , LYS C:41 , TYR C:42 , ASP C:64 , TYR C:87 , ILE C:105 , LEU C:106 , PRO C:107 , ASN C:108 , HIS C:111 , GLU C:128 , LYS C:129 , ARG C:157 , TRP C:199 , ARG C:200 , TYR C:217 , TYR C:296 , HOH C:601 , HOH C:658 , HOH C:659 , HOH C:706 , HOH C:728BINDING SITE FOR RESIDUE NAD C 502
4AC4SOFTWAREGLY D:38 , LEU D:39 , GLY D:40 , LYS D:41 , TYR D:42 , ASP D:64 , TYR D:87 , ILE D:105 , LEU D:106 , PRO D:107 , ASN D:108 , HIS D:111 , GLU D:128 , LYS D:129 , ARG D:157 , TRP D:199 , ARG D:200 , TYR D:217 , TYR D:296 , HOH D:651 , HOH D:652 , HOH D:661BINDING SITE FOR RESIDUE NAD D 503

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1EVJ)

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Lys A:129 -Pro A:130
2Asp A:291 -Pro A:292
3Lys B:129 -Pro B:130
4Asp B:291 -Pro B:292
5Lys C:129 -Pro C:130
6Asp C:291 -Pro C:292
7Lys D:129 -Pro D:130
8Asp D:291 -Pro D:292

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1EVJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1EVJ)

(-) Exons   (0, 0)

(no "Exon" information available for 1EVJ)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:340
 aligned with GFO_ZYMMO | Q07982 from UniProtKB/Swiss-Prot  Length:433

    Alignment length:352
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431  
            GFO_ZYMMO    82 RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY 433
               SCOP domains d1evja1 A:30-160,A:323-381 Glucose-fructose oxidoreductase, N-terminal domain                                                      d1evja2 A:161-322 Glucose-fructose oxidoreductase                                                                                                                 d1evja1 A:30-160,A:323-381                                  SCOP domains
               CATH domains 1evjA01 A:30-160,A:319-345 NAD(P)-binding Rossmann-like Domain                                                                     1evjA02 A:161-306,A:346-381 Dihydrodipicolinate Reductase; domain 2                                                                               ------------1evjA01 A:30-160,A:319-345 1evjA02 A:161-306,A:346-381          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhh.hhh.ee...hhhhhhhh....eeee....hhhhhhhhhhhhh..eeee......hhhhhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhhh.......eeeeeee..........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhh..eeeeeeeee....hhhhh....eeeeeeee....eeeeeee.....eeeeeee....eeee..........eeee..------------....hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh..ee........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1evj A  30 RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTP------------MPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY 381
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299      |  -       319       329       339       349       359       369       379  
                                                                                                                                                                                                                                                                                                              306          319                                                              


Chain B from PDB  Type:PROTEIN  Length:338
 aligned with GFO_ZYMMO | Q07982 from UniProtKB/Swiss-Prot  Length:433

    Alignment length:352
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431  
            GFO_ZYMMO    82 RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY 433
               SCOP domains d1evjb1 B:30-160,B:323-381 Glucose-fructose oxidoreductase, N-terminal domain                                                      d1evjb2 B:161-322 Glucose-fructose oxidoreductase                                                                                                                 d1evjb1 B:30-160,B:323-381                                  SCOP domains
               CATH domains 1evjB01 B:30-160,B:321-345 NAD(P)-binding Rossmann-like Domain                                                                     1evjB02 B:161-320,B:346-380 Dihydrodipicolinate Reductase; domain 2                                                                                             1evjB01                  1evjB02 B:161-320,B:346-380        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhh.hhh.ee...hhhhhhhh....eeee....hhhhhhhhhhhhh..eeee......hhhhhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhhh.......eeeeeee..........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhh..eeeeeeeee....hhhhh....eeeeeeee....eeeeeee.....eeeeeee....eeee..........eeee.--------------...hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh..ee........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1evj B  30 RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQT--------------PANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY 381
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299     |   -         -|      329       339       349       359       369       379  
                                                                                                                                                                                                                                                                                                             305            320                                                             


Chain C from PDB  Type:PROTEIN  Length:337
 aligned with GFO_ZYMMO | Q07982 from UniProtKB/Swiss-Prot  Length:433

    Alignment length:352
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431  
            GFO_ZYMMO    82 RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY 433
               SCOP domains d1evjc1 C:30-160,C:323-381 Glucose-fructose oxidoreductase, N-terminal domain                                                      d1evjc2 C:161-322 Glucose-fructose oxidoreductase                                                                                                                 d1evjc1 C:30-160,C:323-381                                  SCOP domains
               CATH domains 1evjC01 C:30-160,C:322-345 NAD(P)-binding Rossmann-like Domain                                                                     1evjC02 C:161-321,C:346-380 Dihydrodipicolinate Reductase; domain 2                                                                                              1evjC01                 1evjC02 C:161-321,C:346-380        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhh.hhh.ee...hhhhhhhh....eeee....hhhhhhhhhhhhh..eeee......hhhhhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhhh.......eeeeeee..........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhh..eeeeeeeee....hhhhh....eeeeeeee....eeeeeee.....eeeeeee....eeee..........eeee.---------------..hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh..ee........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1evj C  30 RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQT---------------ANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY 381
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299     |   -         - |     329       339       349       359       369       379  
                                                                                                                                                                                                                                                                                                             305             321                                                            


Chain D from PDB  Type:PROTEIN  Length:338
 aligned with GFO_ZYMMO | Q07982 from UniProtKB/Swiss-Prot  Length:433

    Alignment length:352
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431  
            GFO_ZYMMO    82 RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVSGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPGHANQSMMPQFIMPANNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY 433
               SCOP domains d1evjd1 D:30-160,D:323-381 Glucose-fructose oxidoreductase, N-terminal domain                                                      d1evjd2 D:161-322 Glucose-fructose oxidoreductase                                                                                                                 d1evjd1 D:30-160,D:323-381                                  SCOP domains
               CATH domains 1evjD01 D:30-160,D:323-345 NAD(P)-binding Rossmann-like Domain                                                                     1evjD02 D:161-322,D:346-380 Dihydrodipicolinate Reductase; domain 2                                                                                               1evjD01                1evjD02 D:161-322,D:346-380        - CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhh.hhh.ee...hhhhhhhh....eeee....hhhhhhhhhhhhh..eeee......hhhhhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhhh.......eeeeeee..........hhhhhhhhhh.hhhhhhhhhhhhhhhhhhh..eeeeeeeee....hhhhh....eeeeeeee....eeeeeee.....eeeeeee....eeee..........eeee...--------------.hhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh..ee........... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1evj D  30 RRFGYAIVGLGKYALNQILPGFAGCQHSRIEALVDGNAEKAKIVAAEYGVDPRKIYDYSNFDKIAKDPKIDAVYIILPNSLHAEFAIRAFKAGKHVMCEKPMATSVADCQRMIDAAKAANKKLMIGYRCHYDPMNRAAVKLIRENQLGKLGMVTTDNSDVMDQNDPAQQWRLRRELAGGGSLMDIGIYGLNGTRYLLGEEPIEVRAYTYSDPNDERFVEVEDRIIWQMRFRSGALSHGASSYSTTTTSRFSVQGDKAVLLMDPATGYYQNLISVQTPG--------------NNQFSAQLDHLAEAVINNKPVRSPGEEGMQDVRLIQAIYEAARTGRPVNTDWGYVRQGGY 381
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       | -         -  |    329       339       349       359       369       379  
                                                                                                                                                                                                                                                                                                               307            322
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1EVJ)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (GFO_ZYMMO | Q07982)
molecular function
    GO:0047061    glucose-fructose oxidoreductase activity    Catalysis of the reaction: D-fructose + D-glucose = D-glucitol + D-glucono-1,5-lactone.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0006061    sorbitol biosynthetic process    The chemical reactions and pathways resulting in the formation of sorbitol (D-glucitol), one of the ten stereoisomeric hexitols. It can be derived from glucose by reduction of the aldehyde group.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:291 - Pro A:292   [ RasMol ]  
    Asp B:291 - Pro B:292   [ RasMol ]  
    Asp C:291 - Pro C:292   [ RasMol ]  
    Asp D:291 - Pro D:292   [ RasMol ]  
    Lys A:129 - Pro A:130   [ RasMol ]  
    Lys B:129 - Pro B:130   [ RasMol ]  
    Lys C:129 - Pro C:130   [ RasMol ]  
    Lys D:129 - Pro D:130   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1evj
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GFO_ZYMMO | Q07982
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GFO_ZYMMO | Q07982
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GFO_ZYMMO | Q07982: 1h6a 1h6b 1h6c 1h6d 1ofg 1ryd 1rye

(-) Related Entries Specified in the PDB File

1ofg 1OFG IS WILD-TYPE GFOR