1AGR - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   COMPLEX OF ALF4-ACTIVATED GI-ALPHA-1 WITH RGS4

Authors :   J. J. G. Tesmer, S. R. Sprang

Date :   25 Mar 97 (Deposition) - 16 Jun 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,D,E,H
Biol. Unit 1: A,E  (1x)
Biol. Unit 2: D,H  (1x)

Keywords :   Gi-Alpha-1, Hydrolase, Signal Transduction, Rgs4, Complex (Signal Transduction/Regulator), Gtp-Binding, Gtpase Activating Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. J. Tesmer, D. M. Berman, A. G. Gilman, S. R. Sprang
Structure Of Rgs4 Bound To Alf4--Activated G(I Alpha1): Stabilization Of The Transition State For Gtp Hydrolysis.
Cell(Cambridge, Mass. ) V. 89 251 1997
PubMed-ID: 9108480 | Reference-DOI: 10.1016/S0092-8674(00)80204-4
(for further references see the PDB file header)

Molecule 1 - GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)
	Cell Line	:	BL21
	Chains	:	A, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PQE6/GIA1
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Fragment	:	ALPHA-1
	Organ	:	BRAIN
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	GI-ALPHA-1

Molecule 2 - RGS4
	Cell Line	:	BL21
	Chains	:	E, H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PQE60-H6RGS4
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Organ	:	BRAIN
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	REGULATOR OF G-PROTEIN SIGNALLING 4

		1	2	3	4
Asymmetric Unit	:	A	D	E	H
Biological Unit 1 (1x)	:	A		E
Biological Unit 2 (1x)	:		D		H

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (4, 8)

No.	Name	Count	Type	Full Name
1	ALF	2	Ligand/Ion	TETRAFLUOROALUMINATE ION
2	CIT	2	Ligand/Ion	CITRIC ACID
3	GDP	2	Ligand/Ion	GUANOSINE-5'-DIPHOSPHATE
4	MG	2	Ligand/Ion	MAGNESIUM ION

Biological Unit 1 (3, 3)

No.	Name	Count	Type	Full Name
1	ALF	1	Ligand/Ion	TETRAFLUOROALUMINATE ION
2	CIT	1	Ligand/Ion	CITRIC ACID
3	GDP	1	Ligand/Ion	GUANOSINE-5'-DIPHOSPHATE
4	MG	-1	Ligand/Ion	MAGNESIUM ION

Biological Unit 2 (3, 3)

No.	Name	Count	Type	Full Name
1	ALF	1	Ligand/Ion	TETRAFLUOROALUMINATE ION
2	CIT	1	Ligand/Ion	CITRIC ACID
3	GDP	1	Ligand/Ion	GUANOSINE-5'-DIPHOSPHATE
4	MG	-1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:47 , THR A:181 , GDP A:355 , ALF A:357 , HOH A:364 , HOH A:365	BINDING SITE FOR RESIDUE MG A 356
2	AC2	SOFTWARE	GLY A:42 , GLU A:43 , LYS A:46 , ARG A:178 , LYS A:180 , THR A:181 , VAL A:201 , GLY A:202 , GLY A:203 , GLN A:204 , GDP A:355 , MG A:356 , HOH A:359A , HOH A:364 , HOH A:365	BINDING SITE FOR RESIDUE ALF A 357
3	AC3	SOFTWARE	SER D:47 , THR D:181 , GDP D:355 , ALF D:357 , HOH D:365 , HOH D:366	BINDING SITE FOR RESIDUE MG D 356
4	AC4	SOFTWARE	GLY D:42 , GLU D:43 , LYS D:46 , ARG D:178 , LYS D:180 , THR D:181 , VAL D:201 , GLY D:202 , GLY D:203 , GLN D:204 , GDP D:355 , MG D:356 , HOH D:360D , HOH D:365 , HOH D:366	BINDING SITE FOR RESIDUE ALF D 357
5	AC5	SOFTWARE	GLU A:43 , SER A:44 , GLY A:45 , LYS A:46 , SER A:47 , THR A:48 , SER A:151 , LEU A:175 , ARG A:176 , THR A:177 , ARG A:178 , ASN A:269 , LYS A:270 , ASP A:272 , LEU A:273 , CYS A:325 , ALA A:326 , THR A:327 , MG A:356 , ALF A:357 , HOH A:360 , HOH A:361 , HOH A:364 , HOH A:365	BINDING SITE FOR RESIDUE GDP A 355
6	AC6	SOFTWARE	GLU A:275 , THR A:295 , TYR A:296 , GLU A:297 , HOH A:384 , LYS D:271 , HIS D:322 , PHE D:323 , ASN D:331 , PHE D:334 , HOH D:384	BINDING SITE FOR RESIDUE CIT A 358
7	AC7	SOFTWARE	GLU D:43 , SER D:44 , GLY D:45 , LYS D:46 , SER D:47 , THR D:48 , SER D:151 , LEU D:175 , ARG D:176 , THR D:177 , ARG D:178 , ASN D:269 , LYS D:270 , ASP D:272 , LEU D:273 , CYS D:325 , ALA D:326 , THR D:327 , MG D:356 , ALF D:357 , HOH D:361 , HOH D:362 , HOH D:365 , HOH D:366	BINDING SITE FOR RESIDUE GDP D 355
8	AC8	SOFTWARE	LYS A:271 , HIS A:322 , PHE A:323 , ASN A:331 , GLU D:275 , THR D:295 , TYR D:296 , GLU D:297 , HOH D:359	BINDING SITE FOR RESIDUE CIT D 358

(no "SS Bond" information available for 1AGR)

(no "Cis Peptide Bond" information available for 1AGR)

(no "SAP(SNP)/Variant" information available for 1AGR)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS4_RAT	62-178	2	E:62-178 H:62-175

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS4_RAT	62-178	1	E:62-178 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RGS	PS50132	RGS domain profile.	RGS4_RAT	62-178	1	- H:62-175

Asymmetric Unit (3, 6)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000003774	1	ENSRNOE00000026170	chr13:85540173-85540022	152	RGS4_RAT	1-15	15	0	-	-
1.2	ENSRNOT00000003774	2	ENSRNOE00000026215	chr13:85537784-85537680	105	RGS4_RAT	15-50	36	0	-	-
1.3	ENSRNOT00000003774	3	ENSRNOE00000026289	chr13:85537249-85537188	62	RGS4_RAT	50-71	22	2	E:51-71 H:60-71	21 12
1.4	ENSRNOT00000003774	4	ENSRNOE00000026356	chr13:85536895-85536729	167	RGS4_RAT	71-126	56	2	E:71-126 H:71-126	56 56
1.5	ENSRNOT00000003774	5	ENSRNOE00000026404	chr13:85536312-85533882	2431	RGS4_RAT	127-205	79	2	E:127-178 H:127-175	52 49

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:350
 aligned with GNAI1_RAT | P10824 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:350
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354
            GNAI1_RAT     5 LSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354
               SCOP domains d1agra2 A:5-60,A:182-354 Transducin (alpha subunit)     d1agra1 A:61-181 Transducin (alpha subunit), insertion domain                                                            d1agra2 A:5-60,A:182-354 Transducin (alpha subunit)                                                                                                                           SCOP domains
               CATH domains ---1agrA01 A:8-61,A:181-352                              1agrA02 A:62-180 GI Alpha 1, domain 2-like                                                                             1agrA01 A:8-61,A:181-352 P-loop containing nucleotide triphosphate hydrolases                                                                                               -- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhheeeeeee......hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.hhhhhhhhh.........hhhhh..hhhhh.......hhhhhh.......eeeeeeee..eeeeeeee...hhhhhhhhhh.....eeeeeeehhh............hhhhhhhhhhhhh..hhh...eeeeeee.hhhhhhhhhh..hhh..........hhhhhhhhhhhhhhh.........eee......hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1agr A   5 LSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354

Chain D from PDB  Type:PROTEIN  Length:344
 aligned with GNAI1_RAT | P10824 from UniProtKB/Swiss-Prot  Length:354

    Alignment length:344
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350    
            GNAI1_RAT    11 AAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354
               SCOP domains d1agrd2 D:11-60,D:182-354                         d1agrd1 D:61-181 Transducin (alpha subunit), insertion domain                                                            d1agrd2 D:11-60,D:182-354 Transducin (alpha subunit)                                                                                                                          SCOP domains
               CATH domains 1agrD01 D:11-61,D:181-352                          1agrD02 D:62-180 GI Alpha 1, domain 2-like                                                                             1agrD01 D:11-61,D:181-352 P-loop containing nucleotide triphosphate hydrolases                                                                                              -- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhheeeeeee......hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh.......hhhhhhhhhhh..hhhhhhhhh.........hhhhh..hhhhh.......hhhhhh.......eeeeeeee..eeeeeeee...hhhhhhhhhh.....eeeeeeehhh............hhhhhhhhhhhhh..hhh...eeeeeee.hhhhhhhhhh..hhh..........hhhhhhhhhhhhhhh.........eee......hhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1agr D  11 AAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350

Chain E from PDB  Type:PROTEIN  Length:128
 aligned with RGS4_RAT | P49799 from UniProtKB/Swiss-Prot  Length:205

    Alignment length:128
                                    60        70        80        90       100       110       120       130       140       150       160       170        
             RGS4_RAT    51 VSQEEVKKWAESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLT 178
               SCOP domains d1agre_ E: Regulator of G-protein signaling 4, RGS4                                                                              SCOP domains
               CATH domains 1agrE01 E:51-83,E:164-177        1agrE02 E:84-163 Regulator of G-protein Signalling 4, domain 2                  1agrE01       - CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh.hhhhhh.hhhhhhhhhhhhh...hhhhhhhhhhhhhhh.....hhhhhhhhhhhhh............hhhhhhhhhhhh.......hhhhhhhhhhhhh.hhhhhhh.hhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------RGS  PDB: E:62-178 UniProt: 62-178                                                                                    PROSITE
           Transcript 1 (1) Exon 1.3  PDB: E:51-7-------------------------------------------------------Exon 1.5  PDB: E:127-178 UniProt: 127-205            Transcript 1 (1)
           Transcript 1 (2) --------------------Exon 1.4  PDB: E:71-126 UniProt: 71-126                 ---------------------------------------------------- Transcript 1 (2)
                 1agr E  51 VSQEEVKKWAESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLT 178
                                    60        70        80        90       100       110       120       130       140       150       160       170

Chain H from PDB  Type:PROTEIN  Length:116
 aligned with RGS4_RAT | P49799 from UniProtKB/Swiss-Prot  Length:205

    Alignment length:116
                                    69        79        89        99       109       119       129       139       149       159       169      
             RGS4_RAT    60 AESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYL 175
               SCOP domains d1agrh_ H: Regulator of G-protein signaling 4, RGS4                                                                  SCOP domains
               CATH domains 1agrH01                 1agrH02 H:84-163 Regulator of G-protein Signalling 4, domain 2                  1agrH01      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh.hhhhhhhhhhhhh...hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh............hhhhhhhhh..........hhhhhhhhhhhhh.hhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --RGS  PDB: H:62-175 UniProt: 62-178                                                                                 PROSITE
           Transcript 1 (1) Exon 1.3    -------------------------------------------------------Exon 1.5  PDB: H:127-175 UniProt: 127-205         Transcript 1 (1)
           Transcript 1 (2) -----------Exon 1.4  PDB: H:71-126 UniProt: 71-126                 ------------------------------------------------- Transcript 1 (2)
                 1agr H  60 AESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYL 175
                                    69        79        89        99       109       119       129       139       149       159       169

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "Pfam Domain" information available for 1AGR)

Asymmetric Unit(hide GO term definitions)

Chain A,D (GNAI1_RAT | P10824)

molecular function
	GO:0031683	G-protein beta/gamma-subunit complex binding	Interacting selectively and non-covalently with a complex of G-protein beta/gamma subunits.
	GO:0001664	G-protein coupled receptor binding	Interacting selectively and non-covalently with a G-protein coupled receptor.
	GO:0031821	G-protein coupled serotonin receptor binding	Interacting selectively and non-covalently with a metabotropic serotonin receptor.
	GO:0019003	GDP binding	Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0032794	GTPase activating protein binding	Interacting selectively and non-covalently with a GTPase activating protein.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0019001	guanyl nucleotide binding	Interacting selectively and non-covalently with guanyl nucleotides, any compound consisting of guanosine esterified with (ortho)phosphate.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through activation or inhibition of adenylyl cyclase activity and a subsequent change in the concentration of cyclic AMP (cAMP).
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:1904322	cellular response to forskolin	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a forskolin stimulus.
	GO:0050805	negative regulation of synaptic transmission	Any process that stops, prevents, or reduces the frequency, rate or extent of synaptic transmission, the process of communication from a neuron to a target (neuron, muscle, or secretory cell) across a synapse.
	GO:0043949	regulation of cAMP-mediated signaling	Any process which modulates the frequency, rate or extent of cAMP-mediated signaling, a series of molecular signals in which a cell uses cyclic AMP to convert an extracellular signal into a response.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005834	heterotrimeric G-protein complex	Any of a family of heterotrimeric GTP-binding and hydrolyzing proteins; they belong to a superfamily of GTPases that includes monomeric proteins such as EF-Tu and RAS. Heterotrimeric G-proteins consist of three subunits; the alpha subunit contains the guanine nucleotide binding site and possesses GTPase activity; the beta and gamma subunits are tightly associated and function as a beta-gamma heterodimer; extrinsic plasma membrane proteins (cytoplasmic face) that function as a complex to transduce signals from G-protein coupled receptors to an effector protein.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0030496	midbody	A thin cytoplasmic bridge formed between daughter cells at the end of cytokinesis. The midbody forms where the contractile ring constricts, and may persist for some time before finally breaking to complete cytokinesis.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Chain E,H (RGS4_RAT | P49799)

molecular function
	GO:0001965	G-protein alpha-subunit binding	Interacting selectively and non-covalently with a G-protein alpha subunit. The alpha subunit binds a guanine nucleotide.
	GO:0005096	GTPase activator activity	Binds to and increases the activity of a GTPase, an enzyme that catalyzes the hydrolysis of GTP.
biological process
	GO:0045744	negative regulation of G-protein coupled receptor protein signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of G-protein coupled receptor protein signaling pathway activity.
	GO:0009968	negative regulation of signal transduction	Any process that stops, prevents, or reduces the frequency, rate or extent of signal transduction.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ALF	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CIT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GDP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1agr)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1agr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GNAI1_RAT \| P10824
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	RGS4_RAT \| P49799
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GNAI1_RAT \| P10824
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	RGS4_RAT \| P49799
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1AGR)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (3, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (3, 6)

CATH Domains (4, 8)

Pfam Domains (0, 0)

Gene Ontology (41, 46)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File