1ZZY - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with THIO_ECO57 | P0AA27 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_ECO57     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzya_ A: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyA00 A:3-108 Glutaredoxin                                                                               CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (5)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy A   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with THIO_ECOL6 | P0AA26 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_ECOL6     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzya_ A: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyA00 A:3-108 Glutaredoxin                                                                               CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy A   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with THIO_ECOLI | P0AA25 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_ECOLI     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzya_ A: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyA00 A:3-108 Glutaredoxin                                                                               CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy A   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with THIO_SALTI | P0AA29 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_SALTI     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzya_ A: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyA00 A:3-108 Glutaredoxin                                                                               CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy A   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with THIO_SALTY | P0AA28 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_SALTY     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzya_ A: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyA00 A:3-108 Glutaredoxin                                                                               CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy A   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain A from PDB  Type:PROTEIN  Length:106
 aligned with THIO_SHIFL | P0AA30 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_SHIFL     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzya_ A: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyA00 A:3-108 Glutaredoxin                                                                               CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy A   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain B from PDB  Type:PROTEIN  Length:106
 aligned with THIO_ECO57 | P0AA27 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_ECO57     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzyb_ B: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyB00 B:3-108 Glutaredoxin                                                                               CATH domains
           Pfam domains (1) Thioredoxin-1zzyB01 B:3-106                                                                             -- Pfam domains (1)
           Pfam domains (2) Thioredoxin-1zzyB02 B:3-106                                                                             -- Pfam domains (2)
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (5)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy B   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain B from PDB  Type:PROTEIN  Length:106
 aligned with THIO_ECOL6 | P0AA26 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_ECOL6     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzyb_ B: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyB00 B:3-108 Glutaredoxin                                                                               CATH domains
           Pfam domains (1) Thioredoxin-1zzyB01 B:3-106                                                                             -- Pfam domains (1)
           Pfam domains (2) Thioredoxin-1zzyB02 B:3-106                                                                             -- Pfam domains (2)
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (4)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy B   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain B from PDB  Type:PROTEIN  Length:106
 aligned with THIO_ECOLI | P0AA25 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_ECOLI     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzyb_ B: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyB00 B:3-108 Glutaredoxin                                                                               CATH domains
           Pfam domains (1) Thioredoxin-1zzyB01 B:3-106                                                                             -- Pfam domains (1)
           Pfam domains (2) Thioredoxin-1zzyB02 B:3-106                                                                             -- Pfam domains (2)
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy B   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain B from PDB  Type:PROTEIN  Length:106
 aligned with THIO_SALTI | P0AA29 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_SALTI     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzyb_ B: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyB00 B:3-108 Glutaredoxin                                                                               CATH domains
           Pfam domains (1) Thioredoxin-1zzyB01 B:3-106                                                                             -- Pfam domains (1)
           Pfam domains (2) Thioredoxin-1zzyB02 B:3-106                                                                             -- Pfam domains (2)
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy B   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain B from PDB  Type:PROTEIN  Length:106
 aligned with THIO_SALTY | P0AA28 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_SALTY     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzyb_ B: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyB00 B:3-108 Glutaredoxin                                                                               CATH domains
           Pfam domains (1) Thioredoxin-1zzyB01 B:3-106                                                                             -- Pfam domains (1)
           Pfam domains (2) Thioredoxin-1zzyB02 B:3-106                                                                             -- Pfam domains (2)
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy B   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Chain B from PDB  Type:PROTEIN  Length:106
 aligned with THIO_SHIFL | P0AA30 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:106
                                    13        23        33        43        53        63        73        83        93       103      
           THIO_SHIFL     4 KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 109
               SCOP domains d1zzyb_ B: Thioredoxin                                                                                     SCOP domains
               CATH domains 1zzyB00 B:3-108 Glutaredoxin                                                                               CATH domains
           Pfam domains (1) Thioredoxin-1zzyB01 B:3-106                                                                             -- Pfam domains (1)
           Pfam domains (2) Thioredoxin-1zzyB02 B:3-106                                                                             -- Pfam domains (2)
         Sec.struct. author ..ee....hhhhhh.....eeeeeee...hhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhh......eeeeee..eeeeeee...hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------- PROSITE (4)
                PROSITE (5) ---------------------------------------------------------------------------------------------------------- PROSITE (5)
                PROSITE (6) ---------------------THIOREDOXIN_1      ------------------------------------------------------------------ PROSITE (6)
                 Transcript ---------------------------------------------------------------------------------------------------------- Transcript
                 1zzy B   3 KIIHVTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA 108
                                    12        22        32        42        52        62        72        82        92       102

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,B (THIO_ECO57 | P0AA27)

molecular function
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0006662	glycerol ether metabolic process	The chemical reactions and pathways involving glycerol ethers, any anhydride formed between two organic hydroxy compounds, one of which is glycerol.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005623	cell	The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

Chain A,B (THIO_SHIFL | P0AA30)

molecular function
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0006662	glycerol ether metabolic process	The chemical reactions and pathways involving glycerol ethers, any anhydride formed between two organic hydroxy compounds, one of which is glycerol.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005623	cell	The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

Chain A,B (THIO_SALTY | P0AA28)

molecular function
	GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a sulfur-containing group acts as a hydrogen or electron donor and reduces disulfide.
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0034599	cellular response to oxidative stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0006662	glycerol ether metabolic process	The chemical reactions and pathways involving glycerol ethers, any anhydride formed between two organic hydroxy compounds, one of which is glycerol.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
	GO:0000103	sulfate assimilation	The pathways by which inorganic sulfate is processed and incorporated into sulfated compounds.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain A,B (THIO_ECOL6 | P0AA26)

molecular function
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0006662	glycerol ether metabolic process	The chemical reactions and pathways involving glycerol ethers, any anhydride formed between two organic hydroxy compounds, one of which is glycerol.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005623	cell	The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

Chain A,B (THIO_SALTI | P0AA29)

molecular function
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0006662	glycerol ether metabolic process	The chemical reactions and pathways involving glycerol ethers, any anhydride formed between two organic hydroxy compounds, one of which is glycerol.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005623	cell	The basic structural and functional unit of all organisms. Includes the plasma membrane and any external encapsulating structures such as the cell wall and cell envelope.

Chain A,B (THIO_ECOLI | P0AA25)

molecular function
	GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which a sulfur-containing group acts as a hydrogen or electron donor and reduces disulfide.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
biological process
	GO:0045454	cell redox homeostasis	Any process that maintains the redox environment of a cell or compartment within a cell.
	GO:0034599	cellular response to oxidative stress	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0006662	glycerol ether metabolic process	The chemical reactions and pathways involving glycerol ethers, any anhydride formed between two organic hydroxy compounds, one of which is glycerol.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
	GO:0000103	sulfate assimilation	The pathways by which inorganic sulfate is processed and incorporated into sulfated compounds.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (2, 2)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (13, 40)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File