|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 24) Biological Unit 1 (2, 12) Biological Unit 2 (2, 12) |
Asymmetric Unit (12, 12)
|
(no "SS Bond" information available for 1ZG5) |
(no "Cis Peptide Bond" information available for 1ZG5) |
(no "SAP(SNP)/Variant" information available for 1ZG5) |
Asymmetric Unit (1, 4)
|
(no "Exon" information available for 1ZG5) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:66 aligned with NARL_ECOLI | P0AF28 from UniProtKB/Swiss-Prot Length:216 Alignment length:66 160 170 180 190 200 210 NARL_ECOLI 151 RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF 216 SCOP domains d1zg5a1 A:151-216 Nitrate/nitrite response regulator (NarL) SCOP domains CATH domains 1zg5A00 A:151-216 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE -------------------HTH_LUXR_1 PDB: A:170-197 ------------------- PROSITE Transcript ------------------------------------------------------------------ Transcript 1zg5 A 151 RDVNQLTPRERDILKLIAQGLPNKmIARRLDITESTVKVHVKHmLKKmKLKSRVEAAVWVHQERIF 216 160 170 | 180 190 | 200 210 175-MSE 194-MSE 198-MSE Chain B from PDB Type:PROTEIN Length:66 aligned with NARL_ECOLI | P0AF28 from UniProtKB/Swiss-Prot Length:216 Alignment length:66 160 170 180 190 200 210 NARL_ECOLI 151 RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF 216 SCOP domains d1zg5b1 B:151-216 Nitrate/nitrite response regulator (NarL) SCOP domains CATH domains 1zg5B00 B:151-216 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE -------------------HTH_LUXR_1 PDB: B:170-197 ------------------- PROSITE Transcript ------------------------------------------------------------------ Transcript 1zg5 B 151 RDVNQLTPRERDILKLIAQGLPNKmIARRLDITESTVKVHVKHmLKKmKLKSRVEAAVWVHQERIF 216 160 170 | 180 190 | 200 210 175-MSE 194-MSE 198-MSE Chain C from PDB Type:DNA Length:20 1zg5 C 1 CGTACCCCTATAGGGGTACG 20 10 20 Chain D from PDB Type:DNA Length:20 1zg5 D 21 CGTACCCCTATAGGGGTACG 40 30 40 Chain E from PDB Type:PROTEIN Length:67 aligned with NARL_ECOLI | P0AF28 from UniProtKB/Swiss-Prot Length:216 Alignment length:67 159 169 179 189 199 209 NARL_ECOLI 150 ERDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF 216 SCOP domains -d1zg5e1 E:151-216 Nitrate/nitrite response regulator (NarL) SCOP domains CATH domains 1zg5E00 E:150-216 'winged helix' repressor DNA binding domain CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------HTH_LUXR_1 PDB: E:170-197 ------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 1zg5 E 150 ERDVNQLTPRERDILKLIAQGLPNKmIARRLDITESTVKVHVKHmLKKmKLKSRVEAAVWVHQERIF 216 159 169 | 179 189 | 199 209 175-MSE 194-MSE 198-MSE Chain F from PDB Type:PROTEIN Length:66 aligned with NARL_ECOLI | P0AF28 from UniProtKB/Swiss-Prot Length:216 Alignment length:66 160 170 180 190 200 210 NARL_ECOLI 151 RDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQERIF 216 SCOP domains d1zg5f1 F:151-216 Nitrate/nitrite response regulator (NarL) SCOP domains CATH domains 1zg5F00 F:151-216 'winged helix' repressor DNA binding domain CATH domains Pfam domains (1) --GerE-1zg5F01 F:153-210 ------ Pfam domains (1) Pfam domains (2) --GerE-1zg5F02 F:153-210 ------ Pfam domains (2) Pfam domains (3) --GerE-1zg5F03 F:153-210 ------ Pfam domains (3) Pfam domains (4) --GerE-1zg5F04 F:153-210 ------ Pfam domains (4) SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE -------------------HTH_LUXR_1 PDB: F:170-197 ------------------- PROSITE Transcript ------------------------------------------------------------------ Transcript 1zg5 F 151 RDVNQLTPRERDILKLIAQGLPNKmIARRLDITESTVKVHVKHmLKKmKLKSRVEAAVWVHQERIF 216 160 170 | 180 190 | 200 210 175-MSE 194-MSE 198-MSE Chain G from PDB Type:DNA Length:20 1zg5 G 1 CGTACCCCTATAGGGGTACG 20 10 20 Chain H from PDB Type:DNA Length:20 1zg5 H 21 CGTACCCCTATAGGGGTACG 40 30 40
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,E,F (NARL_ECOLI | P0AF28)
|
|
|
|
|
|
|