|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1XFN) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1XFN) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1XFN) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1XFN) |
Exons (0, 0)| (no "Exon" information available for 1XFN) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:100 aligned with PYP_HALHA | P16113 from UniProtKB/Swiss-Prot Length:125 Alignment length:100 35 45 55 65 75 85 95 105 115 125 PYP_HALHA 26 LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 SCOP domains d1xfna_ A: automated matches SCOP domains CATH domains 1xfnA00 A:26-125 [code=3.30.450.20, no name defined] CATH domains Pfam domains PAS-1xfnA01 A:26-125 Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 1xfn A 26 LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 35 45 55 65 75 85 95 105 115 125
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (PYP_HALHA | P16113)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|