|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 4)
|
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 1OTD) |
(no "Cis Peptide Bond" information available for 1OTD) |
(no "SAP(SNP)/Variant" information available for 1OTD) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 1OTD) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:105 aligned with PYP_HALHA | P16113 from UniProtKB/Swiss-Prot Length:125 Alignment length:105 30 40 50 60 70 80 90 100 110 120 PYP_HALHA 21 GQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 SCOP domains d1otda_ A: Photoactive yellow protein, PYP SCOP domains CATH domains 1otdA00 A:21-125 [code=3.30.450.20, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --PAS PDB: A:23-86 UniProt: 23-86 --------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 1otd A 21 SQLDNLAFGAIQLDGDGTILQYNAAEGDITGRNPKEVIGKNFFKDVAPCTDSPEFSGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 30 40 50 60 70 80 90 100 110 120 Chain B from PDB Type:PROTEIN Length:105 aligned with PYP_HALHA | P16113 from UniProtKB/Swiss-Prot Length:125 Alignment length:105 30 40 50 60 70 80 90 100 110 120 PYP_HALHA 21 GQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 SCOP domains d1otdb_ B: Photoactive yellow protein, PYP SCOP domains CATH domains 1otdB00 B:21-125 [code=3.30.450.20, no name defined] CATH domains Pfam domains (1) PAS-1otdB01 B:21-125 Pfam domains (1) Pfam domains (2) PAS-1otdB02 B:21-125 Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --PAS PDB: B:23-86 UniProt: 23-86 --------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 1otd B 21 SQLDNLAFGAIQLDGDGTILQYNAAEGDITGRNPKEVIGKNFFKDVAPCTDSPEFSGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 30 40 50 60 70 80 90 100 110 120
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (PYP_HALHA | P16113)
|
|
|
|
|
|
|