|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1ODV) |
(no "Cis Peptide Bond" information available for 1ODV) |
(no "SAP(SNP)/Variant" information available for 1ODV) |
(no "PROSITE Motif" information available for 1ODV) |
(no "Exon" information available for 1ODV) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:100 aligned with PYP_HALHA | P16113 from UniProtKB/Swiss-Prot Length:125 Alignment length:100 35 45 55 65 75 85 95 105 115 125 PYP_HALHA 26 LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 SCOP domains d1odva_ A: Photoactive yellow protein, PYP SCOP domains CATH domains 1odvA00 A:26-125 [code=3.30.450.20, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 1odv A 26 LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 35 45 55 65 75 85 95 105 115 125 Chain B from PDB Type:PROTEIN Length:100 aligned with PYP_HALHA | P16113 from UniProtKB/Swiss-Prot Length:125 Alignment length:100 35 45 55 65 75 85 95 105 115 125 PYP_HALHA 26 LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 SCOP domains d1odvb_ B: Photoactive yellow protein, PYP SCOP domains CATH domains 1odvB00 B:26-125 [code=3.30.450.20, no name defined] CATH domains Pfam domains (1) PAS-1odvB01 B:26-125 Pfam domains (1) Pfam domains (2) PAS-1odvB02 B:26-125 Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 1odv B 26 LAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 35 45 55 65 75 85 95 105 115 125
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (PYP_HALHA | P16113)
|
|
|
|
|
|
|