|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1GSW) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1GSW) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1GSW) |
PROSITE Motifs (1, 1)| Asymmetric/Biological Unit (1, 1) |
Exons (0, 0)| (no "Exon" information available for 1GSW) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:122 aligned with PYP_HALHA | P16113 from UniProtKB/Swiss-Prot Length:125 Alignment length:122 13 23 33 43 53 63 73 83 93 103 113 123 PYP_HALHA 4 VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 SCOP domains d1gswa_ A: Photoactive yellow protein, PYP SCOP domains CATH domains 1gswA00 A:4-125 [code=3.30.450.20, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------PAS PDB: A:23-86 UniProt: 23-86 --------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 1gsw A 4 VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITSRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV 125 13 23 33 43 53 63 73 83 93 103 113 123
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1GSW) |
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (PYP_HALHA | P16113)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|