![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 18)
|
Asymmetric Unit (18, 18)
|
(no "SS Bond" information available for 1WRL) |
(no "Cis Peptide Bond" information available for 1WRL) |
Asymmetric Unit (3, 18)
|
Asymmetric Unit (2, 18)
|
Asymmetric Unit (4, 24)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:82 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot Length:161 Alignment length:82 13 23 33 43 53 63 73 83 TNNC1_HUMAN 4 IYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCM 85 SCOP domains d1wrla_ A: automated matches SCOP domains CATH domains 1wrlA00 A:4-85 EF-hand CATH domains Pfam domains ---------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----V--------------------Q------------------------------------------------------Y- SAPs(SNPs) PROSITE (1) -----------------------------EF_HAND_2 EF_HAND_2 PDB: A:52-85 PROSITE (1) PROSITE (2) -------------------------------------------------------------EF_HAND_1 -------- PROSITE (2) Transcript 1 (1) 1.1 Exon 1.2b ------------------------------------------------Exon 1.4b Transcript 1 (1) Transcript 1 (2) ---------------Exon 1.3 PDB: A:19-68 UniProt: 19-68 ----------------- Transcript 1 (2) 1wrl A 4 IYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM 85 13 23 33 43 53 63 73 83 Chain B from PDB Type:PROTEIN Length:83 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot Length:161 Alignment length:83 12 22 32 42 52 62 72 82 TNNC1_HUMAN 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCM 85 SCOP domains d1wrlb_ B: automated matches SCOP domains CATH domains 1wrlB00 B:3-85 EF-hand CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----V--------------------Q------------------------------------------------------Y- SAPs(SNPs) PROSITE (1) ------------------------------EF_HAND_2 EF_HAND_2 PDB: B:52-85 PROSITE (1) PROSITE (2) --------------------------------------------------------------EF_HAND_1 -------- PROSITE (2) Transcript 1 (1) 1.1 Exon 1.2b ------------------------------------------------Exon 1.4b Transcript 1 (1) Transcript 1 (2) ----------------Exon 1.3 PDB: B:19-68 UniProt: 19-68 ----------------- Transcript 1 (2) 1wrl B 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM 85 12 22 32 42 52 62 72 82 Chain C from PDB Type:PROTEIN Length:83 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot Length:161 Alignment length:83 12 22 32 42 52 62 72 82 TNNC1_HUMAN 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCM 85 SCOP domains d1wrlc_ C: automated matches SCOP domains CATH domains 1wrlC00 C:3-85 EF-hand CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----V--------------------Q------------------------------------------------------Y- SAPs(SNPs) PROSITE (1) ------------------------------EF_HAND_2 EF_HAND_2 PDB: C:52-85 PROSITE (1) PROSITE (2) --------------------------------------------------------------EF_HAND_1 -------- PROSITE (2) Transcript 1 (1) 1.1 Exon 1.2b ------------------------------------------------Exon 1.4b Transcript 1 (1) Transcript 1 (2) ----------------Exon 1.3 PDB: C:19-68 UniProt: 19-68 ----------------- Transcript 1 (2) 1wrl C 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM 85 12 22 32 42 52 62 72 82 Chain D from PDB Type:PROTEIN Length:82 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot Length:161 Alignment length:82 12 22 32 42 52 62 72 82 TNNC1_HUMAN 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRC 84 SCOP domains d1wrld_ D: automated matches SCOP domains CATH domains 1wrlD00 D:3-84 EF-hand CATH domains Pfam domains ---------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----V--------------------Q------------------------------------------------------Y SAPs(SNPs) PROSITE (1) ------------------------------EF_HAND_2 EF_HAND_2 PDB: D:52-83 PROSITE (1) PROSITE (2) --------------------------------------------------------------EF_HAND_1 ------- PROSITE (2) Transcript 1 (1) 1.1 Exon 1.2b ------------------------------------------------Exon 1.4b Transcript 1 (1) Transcript 1 (2) ----------------Exon 1.3 PDB: D:19-68 UniProt: 19-68 ---------------- Transcript 1 (2) 1wrl D 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRS 84 12 22 32 42 52 62 72 82 Chain E from PDB Type:PROTEIN Length:83 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot Length:161 Alignment length:83 12 22 32 42 52 62 72 82 TNNC1_HUMAN 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCM 85 SCOP domains d1wrle_ E: automated matches SCOP domains CATH domains 1wrlE00 E:3-85 EF-hand CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -----V--------------------Q------------------------------------------------------Y- SAPs(SNPs) PROSITE (1) ------------------------------EF_HAND_2 EF_HAND_2 PDB: E:52-85 PROSITE (1) PROSITE (2) --------------------------------------------------------------EF_HAND_1 -------- PROSITE (2) Transcript 1 (1) 1.1 Exon 1.2b ------------------------------------------------Exon 1.4b Transcript 1 (1) Transcript 1 (2) ----------------Exon 1.3 PDB: E:19-68 UniProt: 19-68 ----------------- Transcript 1 (2) 1wrl E 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSM 85 12 22 32 42 52 62 72 82 Chain F from PDB Type:PROTEIN Length:82 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot Length:161 Alignment length:82 12 22 32 42 52 62 72 82 TNNC1_HUMAN 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRC 84 SCOP domains d1wrlf_ F: automated matches SCOP domains CATH domains 1wrlF00 F:3-84 EF-hand CATH domains Pfam domains (1) -----------------------------EF_hand_6-1wrlF01 F:32-84 Pfam domains (1) Pfam domains (2) -----------------------------EF_hand_6-1wrlF02 F:32-84 Pfam domains (2) Pfam domains (3) -----------------------------EF_hand_6-1wrlF03 F:32-84 Pfam domains (3) Pfam domains (4) -----------------------------EF_hand_6-1wrlF04 F:32-84 Pfam domains (4) Pfam domains (5) -----------------------------EF_hand_6-1wrlF05 F:32-84 Pfam domains (5) Pfam domains (6) -----------------------------EF_hand_6-1wrlF06 F:32-84 Pfam domains (6) SAPs(SNPs) -----V--------------------Q------------------------------------------------------Y SAPs(SNPs) PROSITE (1) ------------------------------EF_HAND_2 EF_HAND_2 PDB: F:52-83 PROSITE (1) PROSITE (2) --------------------------------------------------------------EF_HAND_1 ------- PROSITE (2) Transcript 1 (1) 1.1 Exon 1.2b ------------------------------------------------Exon 1.4b Transcript 1 (1) Transcript 1 (2) ----------------Exon 1.3 PDB: F:19-68 UniProt: 19-68 ---------------- Transcript 1 (2) 1wrl F 3 DIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRS 84 12 22 32 42 52 62 72 82
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D,E,F (TNNC1_HUMAN | P63316)
|
|
|
|
|
|
|