|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 6)
|
Asymmetric Unit (6, 6)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1VYO) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 3)
|
Asymmetric Unit (4, 8)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:121 aligned with AVID_CHICK | P02701 from UniProtKB/Swiss-Prot Length:152 Alignment length:121 36 46 56 66 76 86 96 106 116 126 136 146 AVID_CHICK 27 KCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRL 147 SCOP domains d1vyoa_ A: automated matches SCOP domains CATH domains 1vyoA00 A:3-123 [code=2.40.128.30, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------T----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) AVIDIN_2 PDB: - UniProt: 26-149 PROSITE (1) PROSITE (2) ---------------------------------------------------------------------------------------------------------AVIDIN_1 - PROSITE (2) Transcript 1 (1) 1Exon 1.4 PDB: A:4-74 UniProt: 28-98 ---------------------------------------Exon 1.6a Transcript 1 (1) Transcript 1 (2) -----------------------------------------------------------------------Exon 1.5 PDB: A:74-114 UniProt: 98-138 --------- Transcript 1 (2) 1vyo A 3 KCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRL 123 12 22 32 42 52 62 72 82 92 102 112 122 Chain B from PDB Type:PROTEIN Length:122 aligned with AVID_CHICK | P02701 from UniProtKB/Swiss-Prot Length:152 Alignment length:122 35 45 55 65 75 85 95 105 115 125 135 145 AVID_CHICK 26 RKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRL 147 SCOP domains d1vyob_ B: automated matches SCOP domains CATH domains 1vyoB00 B:2-123 [code=2.40.128.30, no name defined] CATH domains Pfam domains (1) --Avidin-1vyoB01 B:4-122 - Pfam domains (1) Pfam domains (2) --Avidin-1vyoB02 B:4-122 - Pfam domains (2) SAPs(SNPs) --------------------------------T----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) AVIDIN_2 PDB: B:2-123 UniProt: 26-149 PROSITE (1) PROSITE (2) ----------------------------------------------------------------------------------------------------------AVIDIN_1 - PROSITE (2) Transcript 1 (1) 1.Exon 1.4 PDB: B:4-74 UniProt: 28-98 ---------------------------------------Exon 1.6a Transcript 1 (1) Transcript 1 (2) ------------------------------------------------------------------------Exon 1.5 PDB: B:74-114 UniProt: 98-138 --------- Transcript 1 (2) 1vyo B 2 RKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRL 123 11 21 31 41 51 61 71 81 91 101 111 121
|
Asymmetric Unit
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (AVID_CHICK | P02701)
|
|
|
|
|
|
|