|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 3) Biological Unit 1 (2, 6) |
Asymmetric Unit (5, 5)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1AVD) |
Asymmetric Unit (1, 2)
|
Asymmetric Unit (2, 3)
|
Asymmetric Unit (4, 8)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:123 aligned with AVID_CHICK | P02701 from UniProtKB/Swiss-Prot Length:152 Alignment length:123 36 46 56 66 76 86 96 106 116 126 136 146 AVID_CHICK 27 KCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRT 149 SCOP domains d1avda_ A: Avidin SCOP domains CATH domains 1avdA00 A:3-125 [code=2.40.128.30, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------T------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) AVIDIN_2 PDB: - UniProt: 26-149 PROSITE (1) PROSITE (2) ---------------------------------------------------------------------------------------------------------AVIDIN_1 --- PROSITE (2) Transcript 1 (1) 1Exon 1.4 PDB: A:4-74 UniProt: 28-98 ---------------------------------------Exon 1.6a Transcript 1 (1) Transcript 1 (2) -----------------------------------------------------------------------Exon 1.5 PDB: A:74-114 UniProt: 98-138 ----------- Transcript 1 (2) 1avd A 3 KCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRT 125 12 22 32 42 52 62 72 82 92 102 112 122 Chain B from PDB Type:PROTEIN Length:124 aligned with AVID_CHICK | P02701 from UniProtKB/Swiss-Prot Length:152 Alignment length:124 35 45 55 65 75 85 95 105 115 125 135 145 AVID_CHICK 26 RKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRT 149 SCOP domains d1avdb_ B: Avidin SCOP domains CATH domains 1avdB00 B:2-125 [code=2.40.128.30, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------T------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) AVIDIN_2 PDB: B:2-125 UniProt: 26-149 PROSITE (1) PROSITE (2) ----------------------------------------------------------------------------------------------------------AVIDIN_1 --- PROSITE (2) Transcript 1 (1) 1.Exon 1.4 PDB: B:4-74 UniProt: 28-98 ---------------------------------------Exon 1.6a Transcript 1 (1) Transcript 1 (2) ------------------------------------------------------------------------Exon 1.5 PDB: B:74-114 UniProt: 98-138 ----------- Transcript 1 (2) 1avd B 2 RKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRT 125 11 21 31 41 51 61 71 81 91 101 111 121
|
Asymmetric Unit
|
Asymmetric Unit |
(no "Pfam Domain" information available for 1AVD) |
Asymmetric Unit(hide GO term definitions) Chain A,B (AVID_CHICK | P02701)
|
|
|
|
|
|
|