Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  AVIDIN MUTANT (K3E,K9E,R26D,R124L)
 
Authors :  C. Rosano, P. Arosio, M. Bolognesi
Date :  27 Mar 98  (Deposition) - 15 Jul 98  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Avidin, Biotin Binding Protein, Calycins, Up-And-Down Beta Barrel, Glycoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Nardone, C. Rosano, P. Santambrogio, F. Curnis, A. Corti, F. Magni, A. G. Siccardi, G. Paganelli, R. Losso, B. Apreda, M. Bolognesi, A. Sidoli, P. Arosio
Biochemical Characterization And Crystal Structure Of A Recombinant Hen Avidin And Its Acidic Mutant Expressed In Escherichia Coli.
Eur. J. Biochem. V. 256 453 1998
PubMed-ID: 9760187  |  Reference-DOI: 10.1046/J.1432-1327.1998.2560453.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - AVIDIN
    CellEGG
    Cellular LocationCYTOPLASM (WHITE)
    Cell LineBL21
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidBL21
    Expression System StrainBL21 (DE3)
    Expression System Taxid469008
    MutationYES
    Organism CommonCHICKEN
    Organism ScientificGALLUS GALLUS
    Organism Taxid9031

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2CAM)

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1B1UNKNOWNASN A:12 , SER A:16 , TYR A:33 , THR A:35 , ASN A:118NULL
2B2UNKNOWNASN B:12 , SER B:16 , TYR B:33 , THR B:35 , ASN B:118NULL

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:4 -A:83
2B:4 -B:83

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2CAM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 2)

Asymmetric Unit (1, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_AVID_CHICK_001 *I58TAVID_CHICK  ---  ---A/BI34T
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (1, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_AVID_CHICK_001 *I58TAVID_CHICK  ---  ---A/BI34T
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1AVIDIN_2PS51326 Avidin-like domain profile.AVID_CHICK26-149
 
  2A:2-125
B:2-125
2AVIDIN_1PS00577 Avidin-like domain signature.AVID_CHICK132-146
 
  2A:108-122
B:108-122
Biological Unit 1 (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1AVIDIN_2PS51326 Avidin-like domain profile.AVID_CHICK26-149
 
  4A:2-125
B:2-125
2AVIDIN_1PS00577 Avidin-like domain signature.AVID_CHICK132-146
 
  4A:108-122
B:108-122

(-) Exons   (4, 8)

Asymmetric Unit (4, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSGALT000000038551ENSGALE00000024242Z:8485802-848588281AVID_CHICK1-27272A:2-3
B:2-3
2
2
1.4ENSGALT000000038554ENSGALE00000024240Z:8501440-8501650211AVID_CHICK28-98712A:4-74
B:4-74
71
71
1.5ENSGALT000000038555ENSGALE00000024243Z:8502076-8502196121AVID_CHICK98-138412A:74-114
B:74-114
41
41
1.6aENSGALT000000038556aENSGALE00000024241Z:8502284-8502409126AVID_CHICK138-152152A:114-125
B:114-125
12
12

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:124
 aligned with AVID_CHICK | P02701 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:124
                                    35        45        55        65        75        85        95       105       115       125       135       145    
           AVID_CHICK    26 RKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRT 149
               SCOP domains d2cama_ A: Avidin                                                                                                            SCOP domains
               CATH domains 2camA00 A:2-125  [code=2.40.128.30, no name defined]                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee....eeee.......eeeeeeee.........eeeeeeeee.........eeeeee.......eeeeeeeee.......eeeeeeeee.....hhhhhh.eeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------T------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) AVIDIN_2  PDB: A:2-125 UniProt: 26-149                                                                                       PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------AVIDIN_1       --- PROSITE (2)
           Transcript 1 (1) 1.Exon 1.4  PDB: A:4-74 UniProt: 28-98                                   ---------------------------------------Exon 1.6a    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------Exon 1.5  PDB: A:74-114 UniProt: 98-138  ----------- Transcript 1 (2)
                 2cam A   2 RECSLTGEWTNDLGSNMTIGAVNSDGEFTGTYITAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLLT 125
                                    11        21        31        41        51        61        71        81        91       101       111       121    

Chain B from PDB  Type:PROTEIN  Length:124
 aligned with AVID_CHICK | P02701 from UniProtKB/Swiss-Prot  Length:152

    Alignment length:124
                                    35        45        55        65        75        85        95       105       115       125       135       145    
           AVID_CHICK    26 RKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRT 149
               SCOP domains d2camb_ B: Avidin                                                                                                            SCOP domains
               CATH domains 2camB00 B:2-125  [code=2.40.128.30, no name defined]                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeeee....eeee.......eeeeeee...........eeeeeeee..hhh....eeeeeee......eeeeeeeeee.....eeeeeeeeee.....hhhhhh.eeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------T------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) AVIDIN_2  PDB: B:2-125 UniProt: 26-149                                                                                       PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------AVIDIN_1       --- PROSITE (2)
           Transcript 1 (1) 1.Exon 1.4  PDB: B:4-74 UniProt: 28-98                                   ---------------------------------------Exon 1.6a    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------Exon 1.5  PDB: B:74-114 UniProt: 98-138  ----------- Transcript 1 (2)
                 2cam B   2 RECSLTGEWTNDLGSNMTIGAVNSDGEFTGTYITAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLLT 125
                                    11        21        31        41        51        61        71        81        91       101       111       121    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2CAM)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (AVID_CHICK | P02701)
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2cam)
 
  Sites
    B1  [ RasMol ]  +environment [ RasMol ]
    B2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2cam)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2cam
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AVID_CHICK | P02701
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AVID_CHICK | P02701
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AVID_CHICK | P027011avd 1ave 1ij8 1ldo 1ldq 1lel 1nqn 1rav 1vyo 2a5b 2a5c 2a8g 2avi 2c4i 2jgs 2mf6 3fdc 3mm0 3vgw 3vhh 3vhi 3vhm 4i60 4jhq 4u46 5chk 5hlm 5iru 5irw

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2CAM)