|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (2, 8) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1VWR) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1VWR) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1VWR) |
PROSITE Motifs (2, 2)| Asymmetric Unit (2, 2) Biological Unit 1 (2, 8) |
Exons (0, 0)| (no "Exon" information available for 1VWR) |
Sequences/Alignments
Asymmetric UnitChain B from PDB Type:PROTEIN Length:121 aligned with SAV_STRAV | P22629 from UniProtKB/Swiss-Prot Length:183 Alignment length:121 46 56 66 76 86 96 106 116 126 136 146 156 SAV_STRAV 37 AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 157 SCOP domains d1vwrb_ B: Streptavidin SCOP domains CATH domains 1vwrB00 B:13-133 [code=2.40.128.30, no name defined] CATH domains Pfam domains --Avidin-1vwrB01 B:15-132 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) AVIDIN_2 PDB: B:13-133 UniProt: 37-159 PROSITE (1) PROSITE (2) ---------------------------------------------------------------------------------------------------------AVIDIN_1 - PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------------------------- Transcript 1vwr B 13 AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV 133 22 32 42 52 62 72 82 92 102 112 122 132
Chain P from PDB Type:PROTEIN Length:9
SCOP domains --------- SCOP domains
CATH domains --------- CATH domains
Pfam domains --------- Pfam domains
SAPs(SNPs) --------- SAPs(SNPs)
PROSITE --------- PROSITE
Transcript --------- Transcript
1vwr P 3 HPQGPPCKx 10
||||
8|||
1||
9|
10-NH2
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain B (SAV_STRAV | P22629)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|