|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1SYB) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1SYB) |
PROSITE Motifs (3, 3)| Asymmetric/Biological Unit (3, 3) |
Exons (0, 0)| (no "Exon" information available for 1SYB) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:137 aligned with NUC_STAAU | P00644 from UniProtKB/Swiss-Prot Length:231 Alignment length:137 111 110 | 97 107 | | 116 126 136 146 156 166 176 186 196 206 216 NUC_STAAU 88 KLHKEPATLIKAIDGDTVKLMYK-GQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS 223 SCOP domains d1syba_ A: Staphylococcal nuclease SCOP domains CATH domains 1sybA00 A:6-141 [code=2.40.50.90, no name defined] CATH domains Pfam domains ----------------------------SNase-1sybA01 A:33-141 Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) --TNASE_3 PDB: A:8-141 UniProt: 90-224 PROSITE (1) PROSITE (2) -------------TNASE_1 PDB: A:19-43 ---------------------------------------TNASE_2 ------------------------------------------------ PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 1syb A 6 KLHKEPATLIKAIDGDTVKLMSSNGSPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS 141 15 25 |34 44 54 64 74 84 94 104 114 124 134 32B
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (NUC_STAAU | P00644)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|