1S5L - JenaLib

Asymmetric Unit (108, 108)

No.	Name	Evidence	Residues	Description
001	AC1	SOFTWARE	HIS A:215 , HIS A:272 , HIS D:214 , HIS D:268 , BCT D:353	BINDING SITE FOR RESIDUE FE A 345
002	AC2	SOFTWARE	TYR A:161 , GLN A:165 , ASP A:170 , ALA A:344 , OEC A:347 , ARG C:357	BINDING SITE FOR RESIDUE BCT A 346
003	AC3	SOFTWARE	HIS A:215 , VAL A:219 , TYR A:246 , HIS A:272 , FE A:345 , HIS D:214 , TYR D:244 , LYS D:264 , HIS D:268	BINDING SITE FOR RESIDUE BCT D 353
004	AC4	SOFTWARE	HIS a:2215 , HIS a:2272 , HIS d:2214 , HIS d:2268 , BCT d:2353	BINDING SITE FOR RESIDUE FE a 2345
005	AC5	SOFTWARE	GLN a:2165 , ASP a:2170 , ALA a:2344 , OEC a:2347 , ARG c:2357	BINDING SITE FOR RESIDUE BCT a 2346
006	AC6	SOFTWARE	HIS a:2215 , TYR a:2246 , HIS a:2272 , FE a:2345 , HIS d:2214 , TYR d:2244 , LYS d:2264 , HIS d:2268	BINDING SITE FOR RESIDUE BCT d 2353
007	AC7	SOFTWARE	GLN A:165 , ASP A:170 , GLU A:189 , HIS A:332 , GLU A:333 , HIS A:337 , ASP A:342 , ALA A:344 , BCT A:346 , GLU C:354	BINDING SITE FOR RESIDUE OEC A 347
008	AC8	SOFTWARE	TYR A:147 , PRO A:150 , SER A:153 , ALA A:154 , MET A:183 , ILE A:184 , PHE A:186 , GLN A:187 , ILE A:192 , LEU A:193 , HIS A:198 , GLY A:201 , VAL A:205 , PHE A:206 , THR A:286 , ALA A:287 , ILE A:290 , CLA A:349 , CLA A:350 , PHO A:351 , CLA D:354 , PL9 D:357 , PHE T:17	BINDING SITE FOR RESIDUE CLA A 348
009	AC9	SOFTWARE	MET A:183 , PHE A:206 , CLA A:348 , CLA A:350 , PL9 A:353 , LEU D:122 , VAL D:152 , VAL D:156 , PHE D:181 , PHE D:185 , GLN D:186 , TRP D:191 , THR D:192 , HIS D:197 , VAL D:201 , VAL D:204 , SER D:282 , VAL D:286 , PHO D:355	BINDING SITE FOR RESIDUE CLA D 354
010	BC1	SOFTWARE	VAL A:157 , MET A:172 , ILE A:176 , THR A:179 , PHE A:180 , PHE A:182 , MET A:183 , CLA A:348 , PHO A:351 , MET D:198 , VAL D:201 , LEU D:209 , ILE T:14 , PHE T:17	BINDING SITE FOR RESIDUE CLA A 349
011	BC2	SOFTWARE	GLN A:199 , VAL A:202 , ALA A:203 , TYR A:262 , ALA A:263 , TRP A:278 , CLA A:348 , PL9 A:353 , VAL D:175 , ILE D:178 , PHE D:179 , PHE D:181 , LEU D:182 , CLA D:354 , PHO D:355 , BCR J:53	BINDING SITE FOR RESIDUE CLA A 350
012	BC3	SOFTWARE	LEU A:41 , ALA A:44 , THR A:45 , TYR A:126 , GLN A:130 , ALA A:146 , TYR A:147 , PHE A:158 , LEU A:174 , CLA A:348 , CLA A:349 , ALA D:208 , LEU D:209 , ILE D:213 , PHE D:257	BINDING SITE FOR RESIDUE PHO A 351
013	BC4	SOFTWARE	PHE A:206 , ALA A:209 , LEU A:210 , MET A:214 , CLA A:350 , PL9 A:353 , TRP D:48 , GLY D:118 , PHE D:125 , GLN D:129 , ASN D:142 , PHE D:146 , PHE D:153 , PHE D:173 , LEU D:279 , CLA D:354	BINDING SITE FOR RESIDUE PHO D 355
014	BC5	SOFTWARE	THR A:40 , PHE A:93 , TYR A:94 , PRO A:95 , ILE A:96 , GLN A:113 , LEU A:114 , HIS A:118 , LEU A:121 , SER C:216 , TYR I:9 , PHE I:15	BINDING SITE FOR RESIDUE CLA A 352
015	BC6	SOFTWARE	TYR B:258 , CLA B:519 , CLA B:521 , LMT B:526 , LEU D:43 , HIS D:87 , LEU D:91 , LEU D:92 , TRP D:93 , THR D:112 , PHE D:113 , LEU D:116 , HIS D:117 , LEU D:162 , LEU H:42 , TYR H:48	BINDING SITE FOR RESIDUE CLA D 356
016	BC7	SOFTWARE	LEU C:161 , LEU C:165 , LEU C:213 , ILE C:240 , ILE C:243 , GLY C:247 , TRP C:250 , HIS C:251 , THR C:254 , THR C:255 , PRO C:256 , PHE C:257 , TRP C:259 , ALA C:260 , PHE C:264 , CLA C:477 , CLA C:485	BINDING SITE FOR RESIDUE CLA C 474
017	BC8	SOFTWARE	PRO A:196 , GLN A:199 , PHE A:300 , TRP C:63 , PHE C:70 , GLY C:85 , LEU C:404 , SER C:406 , TRP C:425 , SER C:429 , HIS C:430 , CLA C:476 , CLA C:481 , BCR J:53 , PRO K:17	BINDING SITE FOR RESIDUE CLA C 475
018	BC9	SOFTWARE	ASN C:39 , HIS C:56 , ILE C:60 , PHE C:437 , CLA C:475 , CLA C:478 , CLA C:480 , CLA C:481 , CLA C:483 , CLA C:486 , PRO K:20 , LEU K:24	BINDING SITE FOR RESIDUE CLA C 476
019	CC1	SOFTWARE	MET A:127 , TRP A:131 , TRP C:223 , PHE C:264 , SER C:273 , TYR C:274 , GLY C:277 , ALA C:278 , HIS C:441 , ALA C:445 , ARG C:449 , CLA C:474 , CLA C:485 , VAL I:20 , PHE I:23	BINDING SITE FOR RESIDUE CLA C 477
020	CC2	SOFTWARE	ASN C:39 , ALA C:52 , HIS C:53 , HIS C:56 , HIS C:164 , LEU C:272 , SER C:275 , CLA C:476 , CLA C:480 , CLA C:482 , CLA C:483 , CLA C:485 , CLA C:486	BINDING SITE FOR RESIDUE CLA C 478
021	CC3	SOFTWARE	THR C:94 , LEU C:95 , LEU C:168 , GLY C:171 , ALA C:172 , LEU C:175 , VAL C:233 , HIS C:237 , ILE C:240 , ALA C:278 , MET C:281 , MET C:282 , ILE C:285 , PHE C:289 , VAL C:296 , TYR C:297 , CLA C:480 , CLA C:481 , CLA C:485	BINDING SITE FOR RESIDUE CLA C 479
022	CC4	SOFTWARE	ILE C:60 , VAL C:61 , TRP C:63 , ALA C:64 , THR C:68 , LEU C:88 , HIS C:91 , LEU C:95 , VAL C:114 , HIS C:118 , LEU C:279 , CLA C:476 , CLA C:478 , CLA C:479 , CLA C:481 , CLA C:482	BINDING SITE FOR RESIDUE CLA C 480
023	CC5	SOFTWARE	TRP C:63 , ILE C:87 , HIS C:91 , LEU C:175 , LYS C:178 , PHE C:182 , LEU C:279 , TYR C:297 , HIS C:430 , LEU C:433 , CLA C:475 , CLA C:476 , CLA C:479 , CLA C:480	BINDING SITE FOR RESIDUE CLA C 481
024	CC6	SOFTWARE	LEU C:50 , HIS C:53 , ALA C:57 , ILE C:160 , PHE C:163 , HIS C:164 , VAL C:167 , CLA C:478 , CLA C:480 , CLA C:484	BINDING SITE FOR RESIDUE CLA C 482
025	CC7	SOFTWARE	TRP C:36 , ALA C:37 , LEU C:276 , PHE C:436 , PHE C:437 , VAL C:439 , GLY C:440 , TRP C:443 , HIS C:444 , CLA C:476 , CLA C:478	BINDING SITE FOR RESIDUE CLA C 483
026	CC8	SOFTWARE	VAL C:54 , VAL C:124 , GLY C:128 , TYR C:131 , HIS C:132 , CLA C:482 , BCR C:489	BINDING SITE FOR RESIDUE CLA C 484
027	CC9	SOFTWARE	HIS C:164 , ILE C:240 , PHE C:264 , TYR C:271 , TYR C:274 , SER C:275 , MET C:282 , CLA C:474 , CLA C:477 , CLA C:478 , CLA C:479	BINDING SITE FOR RESIDUE CLA C 485
028	DC1	SOFTWARE	PHE B:139 , ALA B:212 , HIS B:216 , PRO B:222 , LEU B:225 , CLA B:524 , THR H:26 , MET H:30 , PHE H:33 , LEU H:36 , PHE H:37	BINDING SITE FOR RESIDUE CLA B 511
029	DC2	SOFTWARE	HIS B:9 , HIS B:26 , VAL B:30 , LEU B:461 , PHE B:462 , CLA B:513 , CLA B:516 , CLA B:520 , CLA B:523 , BCR B:528	BINDING SITE FOR RESIDUE CLA B 512
030	DC3	SOFTWARE	HIS B:9 , LEU B:19 , HIS B:23 , HIS B:26 , THR B:27 , ILE B:234 , VAL B:237 , LEU B:238 , SER B:241 , VAL B:245 , CLA B:512 , CLA B:516 , CLA B:520 , CLA B:522 , CLA B:523 , CLA B:524	BINDING SITE FOR RESIDUE CLA B 513
031	DC4	SOFTWARE	TRP B:33 , SER B:36 , TYR B:40 , GLN B:58 , GLY B:59 , PHE B:61 , LEU B:324 , PHE B:325 , ARG B:326 , THR B:327 , GLY B:328 , TRP B:450 , CLA B:516 , BCR B:529 , MET D:199 , LEU L:27	BINDING SITE FOR RESIDUE CLA B 514
032	DC5	SOFTWARE	LEU B:69 , TRP B:91 , LEU B:149 , GLY B:152 , PHE B:153 , PHE B:156 , HIS B:157 , PHE B:162 , PRO B:164 , CLA B:517 , CLA B:518	BINDING SITE FOR RESIDUE CLA B 515
033	DC6	SOFTWARE	TRP B:33 , PHE B:61 , ARG B:68 , VAL B:245 , ALA B:248 , ALA B:249 , VAL B:252 , PHE B:451 , HIS B:455 , PHE B:458 , PHE B:462 , CLA B:512 , CLA B:513 , CLA B:514 , CLA B:518	BINDING SITE FOR RESIDUE CLA B 516
034	DC7	SOFTWARE	ARG B:68 , LEU B:149 , CYS B:150 , PHE B:153 , MET B:166 , HIS B:201 , HIS B:202 , ALA B:248 , VAL B:251 , VAL B:252 , THR B:262 , CLA B:515 , CLA B:518 , CLA B:521 , CLA B:524 , PHE H:37 , LEU H:38	BINDING SITE FOR RESIDUE CLA B 517
035	DC8	SOFTWARE	THR B:27 , VAL B:30 , ALA B:31 , TRP B:33 , VAL B:62 , PHE B:65 , MET B:66 , ARG B:68 , LEU B:69 , HIS B:100 , LEU B:103 , GLY B:147 , ALA B:205 , GLY B:209 , CLA B:515 , CLA B:516 , CLA B:517 , CLA B:521 , CLA B:524	BINDING SITE FOR RESIDUE CLA B 518
036	DC9	SOFTWARE	ALA B:243 , HIS B:466 , CLA B:524 , ILE D:123 , MET D:126 , CLA D:356	BINDING SITE FOR RESIDUE CLA B 519
037	EC1	SOFTWARE	TYR B:6 , VAL B:8 , HIS B:9 , VAL B:11 , CLA B:512 , CLA B:513 , CLA B:523 , BCR B:529 , VAL L:10 , VAL M:17 , PRO M:18 , PHE M:21	BINDING SITE FOR RESIDUE CLA B 520
038	EC2	SOFTWARE	PHE B:190 , GLY B:197 , ALA B:200 , HIS B:201 , ALA B:204 , PHE B:247 , PHE B:250 , CLA B:517 , CLA B:518 , CLA B:527 , PHE D:120 , CLA D:356 , PHE H:37 , PHE H:40 , ILE H:44 , TYR H:48	BINDING SITE FOR RESIDUE CLA B 521
039	EC3	SOFTWARE	ILE B:20 , HIS B:23 , LEU B:106 , LEU B:109 , ALA B:110 , ARG B:124 , MET B:138 , ILE B:141 , HIS B:142 , LEU B:145 , CLA B:513 , CLA B:524 , CLA B:525	BINDING SITE FOR RESIDUE CLA B 522
040	EC4	SOFTWARE	TYR B:6 , ARG B:7 , VAL B:8 , HIS B:9 , LEU B:461 , PHE B:462 , PHE B:464 , GLY B:465 , TRP B:468 , HIS B:469 , ARG B:472 , CLA B:512 , CLA B:513 , CLA B:520 , BCR B:528	BINDING SITE FOR RESIDUE CLA B 523
041	EC5	SOFTWARE	LEU B:19 , LEU B:135 , PHE B:139 , HIS B:142 , LEU B:143 , LEU B:225 , MET B:231 , ILE B:234 , VAL B:237 , SER B:240 , SER B:241 , CLA B:511 , CLA B:513 , CLA B:517 , CLA B:518 , CLA B:519 , CLA B:522	BINDING SITE FOR RESIDUE CLA B 524
042	EC6	SOFTWARE	ILE B:20 , TRP B:113 , HIS B:114 , TYR B:117 , LEU B:122 , PHE B:123 , ARG B:124 , CLA B:522	BINDING SITE FOR RESIDUE CLA B 525
043	EC7	SOFTWARE	ILE E:12 , ARG E:17 , TYR E:18 , HIS E:22 , THR E:25 , LEU E:29 , ARG F:18 , TRP F:19 , HIS F:23 , ALA F:26 , VAL F:27 , ILE F:30	BINDING SITE FOR RESIDUE HEM E 84
044	EC8	SOFTWARE	ALA V:36 , CYS V:37 , CYS V:40 , HIS V:41 , LEU V:52 , ASP V:53 , LEU V:54 , THR V:58 , LEU V:72 , TYR V:75 , MET V:76 , TYR V:82 , HIS V:92 , PRO V:93	BINDING SITE FOR RESIDUE HEM V 138
045	EC9	SOFTWARE	CLA A:348 , THR D:217 , TRP D:253 , PHE D:257 , ALA D:260 , PHE D:261 , LEU D:267 , PHE T:18 , ILE T:21 , BCR b:2527	BINDING SITE FOR RESIDUE PL9 D 357
046	FC1	SOFTWARE	PHE A:211 , MET A:214 , HIS A:215 , LEU A:218 , ALA A:251 , HIS A:252 , PHE A:255 , ILE A:259 , ALA A:263 , SER A:264 , PHE A:265 , LEU A:271 , PHE A:274 , CLA A:350 , CLA D:354 , PHO D:355 , BCR J:53	BINDING SITE FOR RESIDUE PL9 A 353
047	FC2	SOFTWARE	TRP C:36 , GLY C:38 , ASN C:39 , ARG C:41 , LEU C:42 , LYS C:48 , ALA C:52 , ALA C:123 , VAL C:130 , ILE C:134 , CLA C:476 , CLA C:478 , BCR C:488 , TRP K:30 , GLN K:31 , MET Z:19 , PRO Z:24 , TRP Z:47	BINDING SITE FOR RESIDUE CLA C 486
048	FC3	SOFTWARE	TYR B:193 , TYR B:258 , TYR B:273 , SER B:277 , HIS D:87 , CLA D:356 , VAL H:59 , SER H:60 , TRP H:61	BINDING SITE FOR RESIDUE LMT B 526
049	FC4	SOFTWARE	PRO B:187 , PHE B:190 , CLA B:521	BINDING SITE FOR RESIDUE CLA B 527
050	FC5	SOFTWARE	ILE A:36 , LEU A:91 , PHE A:117 , PHE A:155 , LEU A:159 , PHE A:168 , PRO C:217 , PHE C:218 , GLY C:220 , GLY C:222 , VAL C:225 , ILE C:285 , PHE C:289 , PHE C:292	BINDING SITE FOR RESIDUE CLA C 487
051	FC6	SOFTWARE	LEU D:43 , GLY D:46 , LEU D:49 , THR D:50 , THR F:29 , PHE F:32 , ILE F:36	BINDING SITE FOR RESIDUE BCR F 48
052	FC7	SOFTWARE	ALA C:55 , VAL C:116 , SER C:122 , GLY C:126 , CLA C:486 , TYR K:6 , PHE K:23 , BCR K:50 , LEU Z:9	BINDING SITE FOR RESIDUE BCR C 488
053	FC8	SOFTWARE	BCR C:488 , ALA J:14 , THR J:15 , GLY J:18 , MET J:19 , LEU K:16 , ILE K:19 , LEU K:22 , PHE K:23 , ALA K:25 , LEU K:26 , PHE K:28 , VAL K:29 , UNK N:16 , UNK N:20 , SER Z:16 , PHE Z:17	BINDING SITE FOR RESIDUE BCR K 50
054	FC9	SOFTWARE	PHE C:109 , VAL C:116 , ILE C:120 , CLA C:484 , TYR K:6 , VAL Z:51 , VAL Z:54 , GLY Z:55	BINDING SITE FOR RESIDUE BCR C 489
055	GC1	SOFTWARE	LEU B:29 , GLY B:32 , GLY B:105 , CLA B:512 , CLA B:523 , PL9 d:2358	BINDING SITE FOR RESIDUE BCR B 528
056	GC2	SOFTWARE	CLA A:350 , PL9 A:353 , CLA C:475 , PHE J:29 , TYR J:33	BINDING SITE FOR RESIDUE BCR J 53
057	GC3	SOFTWARE	MET B:25 , LEU B:29 , ARG B:326 , THR B:327 , CLA B:514 , CLA B:520 , LEU M:6	BINDING SITE FOR RESIDUE BCR B 529
058	GC4	SOFTWARE	GLN a:2165 , ASP a:2170 , GLU a:2189 , HIS a:2332 , GLU a:2333 , HIS a:2337 , ASP a:2342 , ALA a:2344 , BCT a:2346 , GLU c:2354	BINDING SITE FOR RESIDUE OEC a 2347
059	GC5	SOFTWARE	TYR a:2147 , PRO a:2150 , SER a:2153 , ALA a:2154 , VAL a:2157 , MET a:2183 , ILE a:2184 , GLN a:2187 , ILE a:2192 , LEU a:2193 , HIS a:2198 , GLY a:2201 , VAL a:2205 , PHE a:2206 , THR a:2286 , ALA a:2287 , ILE a:2290 , CLA a:2349 , PHO a:2350 , LEU d:2182 , LEU d:2205 , CLA d:2354 , CLA d:2355 , PL9 d:2358 , PHE t:2017	BINDING SITE FOR RESIDUE CLA a 2348
060	GC6	SOFTWARE	MET a:2183 , PHE a:2206 , CLA a:2348 , CLA a:2349 , PL9 a:2352 , LEU d:2122 , VAL d:2152 , VAL d:2156 , PHE d:2181 , LEU d:2182 , PHE d:2185 , GLN d:2186 , TRP d:2191 , HIS d:2197 , VAL d:2201 , VAL d:2204 , SER d:2282 , VAL d:2286 , CLA d:2355 , PHO d:2356	BINDING SITE FOR RESIDUE CLA d 2354
061	GC7	SOFTWARE	MET a:2172 , ILE a:2176 , THR a:2179 , PHE a:2180 , PHE a:2182 , MET a:2183 , CLA a:2348 , PHO a:2350 , MET d:2198 , VAL d:2201 , LEU d:2209 , CLA d:2354	BINDING SITE FOR RESIDUE CLA d 2355
062	GC8	SOFTWARE	GLN a:2199 , VAL a:2202 , ALA a:2203 , PHE a:2206 , TYR a:2262 , ALA a:2263 , PHE a:2265 , TRP a:2278 , CLA a:2348 , PL9 a:2352 , PHE d:2157 , VAL d:2175 , ILE d:2178 , PHE d:2179 , PHE d:2181 , LEU d:2182 , CLA d:2354 , PHO d:2356 , BCR j:2053	BINDING SITE FOR RESIDUE CLA a 2349
063	GC9	SOFTWARE	LEU a:2041 , ALA a:2044 , THR a:2045 , TYR a:2126 , GLN a:2130 , ALA a:2146 , TYR a:2147 , PHE a:2158 , LEU a:2174 , VAL a:2283 , CLA a:2348 , ALA d:2208 , LEU d:2209 , ILE d:2213 , PHE d:2257 , CLA d:2355	BINDING SITE FOR RESIDUE PHO a 2350
064	HC1	SOFTWARE	PHE a:2206 , ALA a:2209 , LEU a:2210 , MET a:2214 , LEU a:2258 , CLA a:2349 , PL9 a:2352 , TRP d:2048 , GLY d:2118 , PHE d:2125 , GLN d:2129 , ASN d:2142 , PHE d:2146 , PRO d:2149 , PHE d:2153 , PHE d:2173 , CLA d:2354	BINDING SITE FOR RESIDUE PHO d 2356
065	HC2	SOFTWARE	PHE a:2093 , TYR a:2094 , PRO a:2095 , ILE a:2096 , TRP a:2097 , GLU a:2098 , LEU a:2114 , HIS a:2118 , LEU a:2121 , SER c:2216 , TYR i:2009 , PHE i:2015	BINDING SITE FOR RESIDUE CLA a 2351
066	HC3	SOFTWARE	TYR b:2258 , CLA b:2519 , CLA b:2521 , CYS d:2040 , HIS d:2087 , LEU d:2091 , LEU d:2092 , TRP d:2093 , THR d:2112 , PHE d:2113 , LEU d:2116 , HIS d:2117 , LEU d:2162 , LMT d:2359 , LEU h:2042 , TYR h:2048	BINDING SITE FOR RESIDUE CLA d 2357
067	HC4	SOFTWARE	LEU c:2161 , LEU c:2165 , LEU c:2213 , ILE c:2240 , ILE c:2243 , HIS c:2251 , THR c:2254 , THR c:2255 , PRO c:2256 , PHE c:2257 , TRP c:2259 , ALA c:2260 , PHE c:2264 , CLA c:2477 , CLA c:2485	BINDING SITE FOR RESIDUE CLA c 2474
068	HC5	SOFTWARE	PRO a:2196 , GLN a:2199 , PHE a:2300 , TRP c:2063 , PHE c:2070 , GLY c:2085 , LEU c:2404 , SER c:2406 , TRP c:2425 , SER c:2429 , HIS c:2430 , CLA c:2476 , CLA c:2481 , BCR j:2053 , PRO k:2017 , VAL k:2021	BINDING SITE FOR RESIDUE CLA c 2475
069	HC6	SOFTWARE	HIS c:2056 , ILE c:2060 , PHE c:2437 , CLA c:2475 , CLA c:2478 , CLA c:2480 , CLA c:2481 , CLA c:2483 , CLA c:2486 , PRO k:2020 , LEU k:2024	BINDING SITE FOR RESIDUE CLA c 2476
070	HC7	SOFTWARE	TRP a:2131 , TRP c:2223 , PHE c:2264 , SER c:2273 , TYR c:2274 , GLY c:2277 , ALA c:2278 , HIS c:2441 , ALA c:2445 , ARG c:2449 , CLA c:2474 , CLA c:2485 , VAL i:2020 , PHE i:2023	BINDING SITE FOR RESIDUE CLA c 2477
071	HC8	SOFTWARE	ASN c:2039 , ALA c:2052 , HIS c:2053 , HIS c:2056 , LEU c:2272 , SER c:2275 , CLA c:2476 , CLA c:2480 , CLA c:2482 , CLA c:2483 , CLA c:2485 , CLA c:2486	BINDING SITE FOR RESIDUE CLA c 2478
072	HC9	SOFTWARE	THR c:2094 , LEU c:2095 , LEU c:2168 , GLY c:2171 , ALA c:2172 , LEU c:2175 , HIS c:2237 , ILE c:2240 , ALA c:2278 , MET c:2281 , MET c:2282 , ILE c:2285 , PHE c:2289 , VAL c:2296 , TYR c:2297 , CLA c:2480 , CLA c:2481 , CLA c:2485	BINDING SITE FOR RESIDUE CLA c 2479
073	IC1	SOFTWARE	ILE c:2060 , VAL c:2061 , TRP c:2063 , ALA c:2064 , THR c:2068 , LEU c:2088 , HIS c:2091 , LEU c:2095 , VAL c:2114 , HIS c:2118 , LEU c:2279 , CLA c:2476 , CLA c:2478 , CLA c:2479 , CLA c:2481 , CLA c:2482	BINDING SITE FOR RESIDUE CLA c 2480
074	IC2	SOFTWARE	TRP c:2063 , ILE c:2087 , HIS c:2091 , LEU c:2175 , LYS c:2178 , PHE c:2182 , LEU c:2279 , TYR c:2297 , LEU c:2426 , HIS c:2430 , LEU c:2433 , CLA c:2475 , CLA c:2476 , CLA c:2479 , CLA c:2480	BINDING SITE FOR RESIDUE CLA c 2481
075	IC3	SOFTWARE	LEU c:2050 , HIS c:2053 , ALA c:2057 , PHE c:2163 , HIS c:2164 , VAL c:2167 , CLA c:2478 , CLA c:2480 , CLA c:2484	BINDING SITE FOR RESIDUE CLA c 2482
076	IC4	SOFTWARE	TRP c:2036 , ALA c:2037 , LEU c:2276 , PHE c:2436 , PHE c:2437 , GLY c:2440 , TRP c:2443 , HIS c:2444 , CLA c:2476 , CLA c:2478	BINDING SITE FOR RESIDUE CLA c 2483
077	IC5	SOFTWARE	VAL c:2054 , VAL c:2124 , GLY c:2128 , TYR c:2131 , HIS c:2132 , CLA c:2482 , BCR c:2489	BINDING SITE FOR RESIDUE CLA c 2484
078	IC6	SOFTWARE	LEU c:2161 , HIS c:2164 , ILE c:2240 , CYS c:2244 , PHE c:2264 , TRP c:2266 , TYR c:2271 , TYR c:2274 , SER c:2275 , MET c:2282 , CLA c:2474 , CLA c:2477 , CLA c:2478 , CLA c:2479	BINDING SITE FOR RESIDUE CLA c 2485
079	IC7	SOFTWARE	PHE b:2139 , ALA b:2212 , HIS b:2216 , PRO b:2222 , LEU b:2225 , CLA b:2524 , THR h:2026 , MET h:2030 , PHE h:2033 , LEU h:2036 , PHE h:2037	BINDING SITE FOR RESIDUE CLA b 2511
080	IC8	SOFTWARE	HIS b:2009 , HIS b:2026 , VAL b:2030 , PHE b:2458 , LEU b:2461 , PHE b:2462 , CLA b:2513 , CLA b:2516 , CLA b:2520 , CLA b:2523 , BCR b:2527	BINDING SITE FOR RESIDUE CLA b 2512
081	IC9	SOFTWARE	HIS b:2009 , LEU b:2019 , HIS b:2023 , HIS b:2026 , THR b:2027 , ILE b:2234 , VAL b:2237 , LEU b:2238 , SER b:2241 , VAL b:2245 , CLA b:2512 , CLA b:2516 , CLA b:2520 , CLA b:2522 , CLA b:2523 , CLA b:2524	BINDING SITE FOR RESIDUE CLA b 2513
082	JC1	SOFTWARE	TRP b:2033 , SER b:2036 , TYR b:2040 , GLN b:2058 , GLY b:2059 , PHE b:2061 , LEU b:2324 , PHE b:2325 , ARG b:2326 , THR b:2327 , GLY b:2328 , TRP b:2450 , CLA b:2516 , BCR b:2528 , MET d:2199 , PHE l:2031	BINDING SITE FOR RESIDUE CLA b 2514
083	JC2	SOFTWARE	LEU b:2069 , TRP b:2091 , GLY b:2152 , PHE b:2153 , PHE b:2156 , HIS b:2157 , PHE b:2162 , PRO b:2164 , CLA b:2517 , CLA b:2518	BINDING SITE FOR RESIDUE CLA b 2515
084	JC3	SOFTWARE	TRP b:2033 , PHE b:2061 , ARG b:2068 , VAL b:2245 , ALA b:2248 , ALA b:2249 , VAL b:2252 , PHE b:2451 , HIS b:2455 , PHE b:2458 , PHE b:2462 , CLA b:2512 , CLA b:2513 , CLA b:2514 , CLA b:2518 , CLA b:2522	BINDING SITE FOR RESIDUE CLA b 2516
085	JC4	SOFTWARE	ARG b:2068 , LEU b:2149 , CYS b:2150 , PHE b:2153 , MET b:2166 , HIS b:2201 , HIS b:2202 , ALA b:2248 , VAL b:2251 , VAL b:2252 , THR b:2262 , CLA b:2515 , CLA b:2518 , CLA b:2521 , CLA b:2524 , PHE h:2037 , LEU h:2038	BINDING SITE FOR RESIDUE CLA b 2517
086	JC5	SOFTWARE	THR b:2027 , VAL b:2030 , ALA b:2031 , VAL b:2062 , PHE b:2065 , MET b:2066 , ARG b:2068 , LEU b:2069 , HIS b:2100 , LEU b:2103 , GLY b:2147 , ALA b:2205 , GLY b:2209 , CLA b:2515 , CLA b:2516 , CLA b:2517 , CLA b:2524	BINDING SITE FOR RESIDUE CLA b 2518
087	JC6	SOFTWARE	ALA b:2243 , HIS b:2466 , CLA b:2524 , ILE d:2123 , MET d:2126 , CLA d:2357	BINDING SITE FOR RESIDUE CLA b 2519
088	JC7	SOFTWARE	TYR b:2006 , VAL b:2008 , HIS b:2009 , VAL b:2011 , CLA b:2512 , CLA b:2513 , CLA b:2523 , BCR b:2528 , VAL l:2010 , VAL m:2017 , PRO m:2018 , PHE m:2021	BINDING SITE FOR RESIDUE CLA b 2520
089	JC8	SOFTWARE	PHE b:2190 , GLY b:2197 , ALA b:2200 , HIS b:2201 , ALA b:2204 , PHE b:2247 , PHE b:2250 , CLA b:2517 , CLA b:2526 , ILE d:2123 , CLA d:2357 , PHE h:2037 , PHE h:2040 , ILE h:2044 , TYR h:2048	BINDING SITE FOR RESIDUE CLA b 2521
090	JC9	SOFTWARE	ILE b:2020 , HIS b:2023 , LEU b:2106 , LEU b:2109 , ALA b:2110 , ARG b:2124 , MET b:2138 , ILE b:2141 , HIS b:2142 , LEU b:2145 , CLA b:2513 , CLA b:2516 , CLA b:2524 , CLA b:2525	BINDING SITE FOR RESIDUE CLA b 2522
091	KC1	SOFTWARE	TYR b:2006 , ARG b:2007 , VAL b:2008 , HIS b:2009 , LEU b:2461 , PHE b:2462 , PHE b:2464 , GLY b:2465 , TRP b:2468 , HIS b:2469 , ARG b:2472 , CLA b:2512 , CLA b:2513 , CLA b:2520 , BCR b:2527	BINDING SITE FOR RESIDUE CLA b 2523
092	KC2	SOFTWARE	LEU b:2019 , LEU b:2135 , PHE b:2139 , HIS b:2142 , LEU b:2143 , LEU b:2225 , MET b:2231 , ILE b:2234 , VAL b:2237 , SER b:2240 , SER b:2241 , CLA b:2511 , CLA b:2513 , CLA b:2517 , CLA b:2518 , CLA b:2519 , CLA b:2522	BINDING SITE FOR RESIDUE CLA b 2524
093	KC3	SOFTWARE	ILE b:2020 , TRP b:2113 , HIS b:2114 , TYR b:2117 , LEU b:2122 , PHE b:2123 , ARG b:2124 , CLA b:2522	BINDING SITE FOR RESIDUE CLA b 2525
094	KC4	SOFTWARE	ILE e:2012 , ARG e:2017 , TYR e:2018 , ILE e:2021 , HIS e:2022 , THR e:2025 , LEU e:2029 , ARG f:2018 , TRP f:2019 , HIS f:2023 , ALA f:2026 , VAL f:2027 , ILE f:2030	BINDING SITE FOR RESIDUE HEM e 2084
095	KC5	SOFTWARE	ALA v:2036 , CYS v:2037 , CYS v:2040 , HIS v:2041 , ASN v:2049 , LEU v:2052 , ASP v:2053 , LEU v:2054 , THR v:2058 , TYR v:2075 , TYR v:2082 , HIS v:2092	BINDING SITE FOR RESIDUE HEM v 2138
096	KC6	SOFTWARE	BCR B:528 , CLA a:2348 , LEU d:2209 , THR d:2217 , TRP d:2253 , PHE d:2257 , ALA d:2260 , PHE d:2261 , LEU d:2267 , PHE t:2018 , ILE t:2021	BINDING SITE FOR RESIDUE PL9 d 2358
097	KC7	SOFTWARE	PHE a:2211 , MET a:2214 , HIS a:2215 , LEU a:2218 , ALA a:2251 , HIS a:2252 , PHE a:2255 , PHE a:2260 , ALA a:2263 , SER a:2264 , PHE a:2265 , LEU a:2271 , PHE a:2274 , CLA a:2349 , CLA d:2354 , PHO d:2356 , BCR j:2053	BINDING SITE FOR RESIDUE PL9 a 2352
098	KC8	SOFTWARE	TRP c:2036 , GLY c:2038 , ASN c:2039 , ARG c:2041 , LEU c:2042 , LYS c:2048 , ALA c:2123 , PHE c:2127 , VAL c:2130 , ILE c:2134 , CLA c:2476 , CLA c:2478 , BCR c:2488 , LEU k:2024 , TRP k:2030 , GLN k:2031 , ARG k:2037 , MET z:2019 , VAL z:2020 , VAL z:2023 , TRP z:2047	BINDING SITE FOR RESIDUE CLA c 2486
099	KC9	SOFTWARE	TYR b:2193 , TYR b:2258 , TYR b:2273 , SER b:2277 , HIS d:2087 , CLA d:2357 , VAL h:2059 , SER h:2060 , TRP h:2061	BINDING SITE FOR RESIDUE LMT d 2359
100	LC1	SOFTWARE	PRO b:2187 , PHE b:2190 , CLA b:2521	BINDING SITE FOR RESIDUE CLA b 2526
101	LC2	SOFTWARE	ILE a:2036 , LEU a:2091 , PHE a:2117 , PHE a:2155 , LEU a:2159 , ILE a:2163 , PHE a:2168 , PRO c:2217 , PHE c:2218 , GLY c:2220 , GLY c:2222 , VAL c:2225 , ILE c:2285 , PHE c:2289 , PHE c:2292	BINDING SITE FOR RESIDUE CLA c 2487
102	LC3	SOFTWARE	LEU d:2043 , GLY d:2046 , LEU d:2049 , PHE d:2113 , PHE f:2032 , LEU f:2033 , ILE f:2036	BINDING SITE FOR RESIDUE BCR d 2360
103	LC4	SOFTWARE	ALA c:2055 , LEU c:2119 , SER c:2122 , GLY c:2126 , CLA c:2486 , TYR k:2006 , PHE k:2023 , BCR k:2050 , LEU z:2009	BINDING SITE FOR RESIDUE BCR c 2488
104	LC5	SOFTWARE	BCR c:2488 , ALA j:2014 , THR j:2015 , GLY j:2018 , MET j:2019 , LEU k:2016 , ILE k:2019 , LEU k:2022 , PHE k:2023 , ALA k:2025 , LEU k:2026 , PHE k:2028 , VAL k:2029 , UNK n:2016 , UNK n:2020 , SER z:2016 , PHE z:2017	BINDING SITE FOR RESIDUE BCR k 2050
105	LC6	SOFTWARE	PHE c:2109 , PHE c:2112 , VAL c:2116 , ILE c:2120 , CLA c:2484 , TYR k:2006 , VAL z:2051 , VAL z:2054 , GLY z:2055	BINDING SITE FOR RESIDUE BCR c 2489
106	LC7	SOFTWARE	PL9 D:357 , LEU b:2029 , GLY b:2032 , GLY b:2105 , CLA b:2512 , CLA b:2523	BINDING SITE FOR RESIDUE BCR b 2527
107	LC8	SOFTWARE	CLA a:2349 , PL9 a:2352 , CLA c:2475 , PHE j:2029 , TYR j:2033	BINDING SITE FOR RESIDUE BCR j 2053
108	LC9	SOFTWARE	MET b:2025 , LEU b:2029 , ARG b:2326 , THR b:2327 , CLA b:2514 , CLA b:2520 , LEU m:2006	BINDING SITE FOR RESIDUE BCR b 2528

SS Bonds (2, 2)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 10)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:333
 aligned with PSBA1_THEEB | P0A444 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:333
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341   
         PSBA1_THEEB     12 NLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhh....................hhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee......ee......ee...hhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l A   12 NLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341

Chain B from PDB  Type:PROTEIN  Length:476
 aligned with PSBB_THEEB | Q8DIQ1 from UniProtKB/Swiss-Prot  Length:510

    Alignment length:476
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475      
          PSBB_THEEB      6 YRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSG  481
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhh..hhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhh.........ee..........ee..............hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh..hhhhhhhhhhhhh..........hhhhh..........eeee.....eeee............eee.....eeee..........hhhhhh.eeee..hhhhh....hhhhhhhhhhhhh.......hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l B    6 YRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSG  481
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475

Chain C from PDB  Type:PROTEIN  Length:421
 aligned with PSBC_THEEB | Q8DIF8 from UniProtKB/Swiss-Prot  Length:461

    Alignment length:421
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443 
          PSBC_THEEB     24 WAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFE  444
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1s5lC02 C:303-397 photosystem ii from thermosynechococcus elongatus                            ----------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh..hhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.........ee.......hhhhhhhhhhh.......hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.hhhhhhhhhhhhhhhhhhh.................eee.....eee.hhhhh........hhh.ee..eehhhhhhhh..hhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l C   36 WAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFE  456
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455

Chain D from PDB  Type:PROTEIN  Length:339
 aligned with PSBD_THEEB | Q8CM25 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:339
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343         
          PSBD_THEEB     14 WFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  352
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.....................ee...hhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh........eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l D   14 WFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  352
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343

Chain E from PDB  Type:PROTEIN  Length:76
 aligned with PSBE_THEEB | Q8DIP0 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:76
                                    18        28        38        48        58        68        78      
          PSBE_THEEB      9 PFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
               SCOP domains ---------------------------------------------------------------------------- SCOP domains
               CATH domains 1s5lE00 E:8-83 Photosystem q(b) protein helix                                CATH domains
               Pfam domains ---------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh..hhhhh...............hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----CYTOCHROME_B559-------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                1s5l E    8 PFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   83
                                    17        27        37        47        57        67        77

Chain F from PDB  Type:PROTEIN  Length:33
 aligned with PSBF_THEEB | Q8DIN9 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:33
                                    22        32        42   
          PSBF_THEEB     13 YPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --CYTOCHROME_B559---------------- PROSITE (2)
                 Transcript --------------------------------- Transcript
                1s5l F   12 YPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   44
                                    21        31        41

Chain H from PDB  Type:PROTEIN  Length:53
 aligned with PSBH_THEEB | Q8DJ43 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:53
                                    23        33        43        53        63   
          PSBH_THEEB     14 LNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG   66
               SCOP domains ----------------------------------------------------- SCOP domains
               CATH domains 1s5lH00 H:13-65                                       CATH domains
               Pfam domains ----------------------------------------------------- Pfam domains
         Sec.struct. author .............hhhhhhhhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------- Transcript
                1s5l H   13 LNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG   65
                                    22        32        42        52        62

Chain I from PDB  Type:PROTEIN  Length:38
 aligned with PSBI_THEEB | Q8DJZ6 from UniProtKB/Swiss-Prot  Length:38

    Alignment length:38
                                    10        20        30        
          PSBI_THEEB      1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE   38
               SCOP domains -------------------------------------- SCOP domains
               CATH domains -------------------------------------- CATH domains
               Pfam domains -------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------- PROSITE
                 Transcript -------------------------------------- Transcript
                1s5l I    1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE   38
                                    10        20        30

Chain J from PDB  Type:PROTEIN  Length:38
 aligned with PSBJ_THEEB | P59087 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:38
                                    12        22        32        
          PSBJ_THEEB      3 SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
               SCOP domains -------------------------------------- SCOP domains
               CATH domains -------------------------------------- CATH domains
               Pfam domains -------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------- PROSITE
                 Transcript -------------------------------------- Transcript
                1s5l J    3 SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
                                    12        22        32

Chain K from PDB  Type:PROTEIN  Length:37
 aligned with PSBK_THEEB | Q9F1K9 from UniProtKB/Swiss-Prot  Length:46

    Alignment length:37
                                    19        29        39       
          PSBK_THEEB     10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR   46
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                1s5l K    1 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR   37
                                    10        20        30

Chain L from PDB  Type:PROTEIN  Length:37
 aligned with PSBL_THEEB | Q8DIN8 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
          PSBL_THEEB      1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                1s5l L    1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
                                    10        20        30

Chain M from PDB  Type:PROTEIN  Length:30
 aligned with PSBM_THEEB | Q8DHA7 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:30
                                    10        20        30
          PSBM_THEEB      1 MEVNQLGLIATALFVLVPSVFLIILYVQTE   30
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                1s5l M    1 MEVNQLGLIATALFVLVPSVFLIILYVQTE   30
                                    10        20        30

Chain N from PDB  Type:PROTEIN  Length:37
                                                                      
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                1s5l N    1 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx   37
                            ||||||||10||||||||20||||||||30|||||||
                            1-UNK|||10-UNK|||19-UNK|||28-UNK|||37-UNK
                             2-UNK|||11-UNK|||20-UNK|||29-UNK||| 
                              3-UNK|| 12-UNK|| 21-UNK|| 30-UNK|| 
                               4-UNK|  13-UNK|  22-UNK|  31-UNK| 
                                5-UNK   14-UNK   23-UNK   32-UNK 
                                 6-UNK   15-UNK   24-UNK   33-UNK
                                  7-UNK   16-UNK   25-UNK   34-UNK
                                   8-UNK   17-UNK   26-UNK   35-UNK
                                    9-UNK   18-UNK   27-UNK   36-UNK

Chain O from PDB  Type:PROTEIN  Length:246
 aligned with PSBO_THEEB | P0A431 from UniProtKB/Swiss-Prot  Length:272

    Alignment length:246
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266      
          PSBO_THEEB     27 AKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA  272
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains -----------------------1s5lO01 O:24-152,O:189-246 Photosystem II, cytochrome c-550 precursor                                                            1s5lO02 O:153-188                   1s5lO01 O:24-152,O:189-246                                 CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhh....................hhhhhh.eeeeeeeeeeeeeee...............ee............eeeee.....eeeee........eee......eee........eee.............eee..ee.............................hhhhhhhhhh.....ee.eeeeee.......eeeeee..ee.............eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1s5l O    1 AKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA  246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240

Chain T from PDB  Type:PROTEIN  Length:31
 aligned with PSBT_THEEB | Q8DIQ0 from UniProtKB/Swiss-Prot  Length:32

    Alignment length:31
                                    10        20        30 
          PSBT_THEEB      1 METITYVFIFACIIALFFFAIFFREPPRITK   31
               SCOP domains ------------------------------- SCOP domains
               CATH domains ------------------------------- CATH domains
               Pfam domains ------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------- PROSITE
                 Transcript ------------------------------- Transcript
                1s5l T    1 METITYVFIFACIIALFFFAIFFREPPRITK   31
                                    10        20        30

Chain U from PDB  Type:PROTEIN  Length:105
 aligned with PSBU_THEEB | Q9F1L5 from UniProtKB/Swiss-Prot  Length:134

    Alignment length:105
                                    39        49        59        69        79        89        99       109       119       129     
          PSBU_THEEB     30 AATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  134
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1s5lU01 U:30-123 Photosystem II 12 kDa extrinsic protein                                      ----------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh..............ee....hhhhhhhh...hhhhhhhhhhh....hhhhhhhh...hhhhhhhhhhhhh.ee....hhhhhh........... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                1s5l U   30 AATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  134
                                    39        49        59        69        79        89        99       109       119       129

Chain V from PDB  Type:PROTEIN  Length:137
 aligned with CY550_THEEB | P0A386 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
         CY550_THEEB     27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1s5lV00 V:1-137 Cytochrome c                                                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhheee......eee.hhhhhhhhhhhhhhhhhhhhh............hhhhhhh......hhhhhhhhhhh........hhhhh..hhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: V:24-123 UniProt: 50-149                                                                 -------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l V    1 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain X from PDB  Type:PROTEIN  Length:40
 aligned with PSBX_THEEB | Q9F1R6 from UniProtKB/Swiss-Prot  Length:41

    Alignment length:40
                                    11        21        31        41
          PSBX_THEEB      2 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL   41
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains 1s5lX00 X:11-50 Single helix bin         CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------- PROSITE
                 Transcript ---------------------------------------- Transcript
                1s5l X   11 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL   50
                                    20        30        40        50

Chain Z from PDB  Type:PROTEIN  Length:58
 aligned with PSBZ_THEEB | Q8DHJ2 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:58
                                    10        20        30        40        50        
          PSBZ_THEEB      1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLN   58
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains 1s5lZ00 Z:1-58 Helix hairpin bin                           CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                1s5l Z    1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLN   58
                                    10        20        30        40        50

Chain a from PDB  Type:PROTEIN  Length:333
 aligned with PSBA1_THEEB | P0A444 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:333
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341   
         PSBA1_THEEB     12 NLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------Photo_RC-1s5la01 a:2028-2330                                                                                                                                                                                                                                                                                   -------------- Pfam domains (1)
           Pfam domains (2) ----------------Photo_RC-1s5la02 a:2028-2330                                                                                                                                                                                                                                                                                   -------------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhh....................hhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee......ee......ee...hhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l a 2012 NLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA 2344
                                  2021      2031      2041      2051      2061      2071      2081      2091      2101      2111      2121      2131      2141      2151      2161      2171      2181      2191      2201      2211      2221      2231      2241      2251      2261      2271      2281      2291      2301      2311      2321      2331      2341

Chain b from PDB  Type:PROTEIN  Length:476
 aligned with PSBB_THEEB | Q8DIQ1 from UniProtKB/Swiss-Prot  Length:510

    Alignment length:476
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475      
          PSBB_THEEB      6 YRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSG  481
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhh..hhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhh.........ee..........ee..............hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhh..hhhhhhhhhhhhh..........hhhhh..........eeee.....eeee............eee.....eeee..........hhhhhh.eeee..hhhhh....hhhhhhhhhhhhh.......hhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l b 2006 YRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSG 2481
                                  2015      2025      2035      2045      2055      2065      2075      2085      2095      2105      2115      2125      2135      2145      2155      2165      2175      2185      2195      2205      2215      2225      2235      2245      2255      2265      2275      2285      2295      2305      2315      2325      2335      2345      2355      2365      2375      2385      2395      2405      2415      2425      2435      2445      2455      2465      2475

Chain c from PDB  Type:PROTEIN  Length:421
 aligned with PSBC_THEEB | Q8DIF8 from UniProtKB/Swiss-Prot  Length:461

    Alignment length:421
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443 
          PSBC_THEEB     24 WAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFE  444
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1s5lc02 c:2303-2397 photosystem ii from thermosynechococcus elongatus                          ----------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh..hhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.........ee.......hhhhhhhh..........hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh.hhhhhhhhhhhhhhhhhhh.................eee.....eee.hhhhh........hhh.ee..eehhhhhhhh..hhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l c 2036 WAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFE 2456
                                  2045      2055      2065      2075      2085      2095      2105      2115      2125      2135      2145      2155      2165      2175      2185      2195      2205      2215      2225      2235      2245      2255      2265      2275      2285      2295      2305      2315      2325      2335      2345      2355      2365      2375      2385      2395      2405      2415      2425      2435      2445      2455

Chain d from PDB  Type:PROTEIN  Length:339
 aligned with PSBD_THEEB | Q8CM25 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:339
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343         
          PSBD_THEEB     14 WFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  352
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------------Photo_RC-1s5ld01 d:2028-2327                                                                                                                                                                                                                                                                                ------------------------- Pfam domains (1)
           Pfam domains (2) --------------Photo_RC-1s5ld02 d:2028-2327                                                                                                                                                                                                                                                                                ------------------------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhh.....................ee...hhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh........eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.......hhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l d 2014 WFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 2352
                                  2023      2033      2043      2053      2063      2073      2083      2093      2103      2113      2123      2133      2143      2153      2163      2173      2183      2193      2203      2213      2223      2233      2243      2253      2263      2273      2283      2293      2303      2313      2323      2333      2343

Chain e from PDB  Type:PROTEIN  Length:76
 aligned with PSBE_THEEB | Q8DIP0 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:76
                                    18        28        38        48        58        68        78      
          PSBE_THEEB      9 PFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
               SCOP domains ---------------------------------------------------------------------------- SCOP domains
               CATH domains 1s5le00 e:2008-2083 Photosystem q(b) protein helix                           CATH domains
           Pfam domains (1) Cytochrom_B559-1s5le01    -------Cytochrom_B559a-1s5le03 e:2041-2080     --- Pfam domains (1)
           Pfam domains (2) Cytochrom_B559-1s5le02    -------Cytochrom_B559a-1s5le04 e:2041-2080     --- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh..hhhhh...............hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----CYTOCHROME_B559-------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------- Transcript
                1s5l e 2008 PFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK 2083
                                  2017      2027      2037      2047      2057      2067      2077

Chain f from PDB  Type:PROTEIN  Length:33
 aligned with PSBF_THEEB | Q8DIN9 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:33
                                    22        32        42   
          PSBF_THEEB     13 YPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
           Pfam domains (1) Cytochrom_B559-1s5lf01 ---------- Pfam domains (1)
           Pfam domains (2) Cytochrom_B559-1s5lf02 ---------- Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                PROSITE (2) --CYTOCHROME_B559---------------- PROSITE (2)
                 Transcript --------------------------------- Transcript
                1s5l f 2012 YPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR 2044
                                  2021      2031      2041

Chain h from PDB  Type:PROTEIN  Length:53
 aligned with PSBH_THEEB | Q8DJ43 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:53
                                    23        33        43        53        63   
          PSBH_THEEB     14 LNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG   66
               SCOP domains ----------------------------------------------------- SCOP domains
               CATH domains 1s5lh00 h:2013-2065                                   CATH domains
           Pfam domains (1) PsbH-1s5lh01 h:2013-2054                  ----------- Pfam domains (1)
           Pfam domains (2) PsbH-1s5lh02 h:2013-2054                  ----------- Pfam domains (2)
         Sec.struct. author .............hhhhhhhhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------- Transcript
                1s5l h 2013 LNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG 2065
                                  2022      2032      2042      2052      2062

Chain i from PDB  Type:PROTEIN  Length:38
 aligned with PSBI_THEEB | Q8DJZ6 from UniProtKB/Swiss-Prot  Length:38

    Alignment length:38
                                    10        20        30        
          PSBI_THEEB      1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE   38
               SCOP domains -------------------------------------- SCOP domains
               CATH domains -------------------------------------- CATH domains
           Pfam domains (1) PsbI-1s5li01 i:2001-2036            -- Pfam domains (1)
           Pfam domains (2) PsbI-1s5li02 i:2001-2036            -- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------- PROSITE
                 Transcript -------------------------------------- Transcript
                1s5l i 2001 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE 2038
                                  2010      2020      2030

Chain j from PDB  Type:PROTEIN  Length:38
 aligned with PSBJ_THEEB | P59087 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:38
                                    12        22        32        
          PSBJ_THEEB      3 SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
               SCOP domains -------------------------------------- SCOP domains
               CATH domains -------------------------------------- CATH domains
           Pfam domains (1) PsbJ-1s5lj01 j:2003-2040               Pfam domains (1)
           Pfam domains (2) PsbJ-1s5lj02 j:2003-2040               Pfam domains (2)
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------- PROSITE
                 Transcript -------------------------------------- Transcript
                1s5l j 2003 SEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL 2040
                                  2012      2022      2032

Chain k from PDB  Type:PROTEIN  Length:37
 aligned with PSBK_THEEB | Q9F1K9 from UniProtKB/Swiss-Prot  Length:46

    Alignment length:37
                                    19        29        39       
          PSBK_THEEB     10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR   46
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
           Pfam domains (1) PsbK-1s5lk01 k:2001-2037              Pfam domains (1)
           Pfam domains (2) PsbK-1s5lk02 k:2001-2037              Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                1s5l k 2001 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR 2037
                                  2010      2020      2030

Chain l from PDB  Type:PROTEIN  Length:37
 aligned with PSBL_THEEB | Q8DIN8 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
          PSBL_THEEB      1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
           Pfam domains (1) PsbL-1s5ll01 l:2001-2037              Pfam domains (1)
           Pfam domains (2) PsbL-1s5ll02 l:2001-2037              Pfam domains (2)
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                1s5l l 2001 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN 2037
                                  2010      2020      2030

Chain m from PDB  Type:PROTEIN  Length:30
 aligned with PSBM_THEEB | Q8DHA7 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:30
                                    10        20        30
          PSBM_THEEB      1 MEVNQLGLIATALFVLVPSVFLIILYVQTE   30
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
           Pfam domains (1) PsbM-1s5lm01 m:2001-2030       Pfam domains (1)
           Pfam domains (2) PsbM-1s5lm02 m:2001-2030       Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                1s5l m 2001 MEVNQLGLIATALFVLVPSVFLIILYVQTE 2030
                                  2010      2020      2030

Chain n from PDB  Type:PROTEIN  Length:37
                                                                      
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                1s5l n 2001 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 2037
                            ||||||2010||||||2020||||||2030|||||||
                            |||||2009-UNK|2018-UNK|2027-UNK|2036-UNK
                         2001-UNK|2010-UNK|2019-UNK|2028-UNK|2037-UNK
                          2002-UNK|2011-UNK|2020-UNK|2029-UNK||  
                           2003-UNK|2012-UNK|2021-UNK|2030-UNK|  
                            2004-UNK 2013-UNK 2022-UNK 2031-UNK  
                             2005-UNK 2014-UNK 2023-UNK 2032-UNK 
                              2006-UNK 2015-UNK 2024-UNK 2033-UNK
                               2007-UNK 2016-UNK 2025-UNK 2034-UNK
                                2008-UNK 2017-UNK 2026-UNK 2035-UNK

Chain o from PDB  Type:PROTEIN  Length:246
 aligned with PSBO_THEEB | P0A431 from UniProtKB/Swiss-Prot  Length:272

    Alignment length:246
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266      
          PSBO_THEEB     27 AKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA  272
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains -----------------------1s5lo01 o:2024-2152,o:2189-2246 Photosystem II, cytochrome c-550 precursor                                                       1s5lo02 o:2153-2188                 1s5lo01 o:2024-2152,o:2189-2246                            CATH domains
           Pfam domains (1) MSP-1s5lo01 o:2001-2244                                                                                                                                                                                                                             -- Pfam domains (1)
           Pfam domains (2) MSP-1s5lo02 o:2001-2244                                                                                                                                                                                                                             -- Pfam domains (2)
         Sec.struct. author .....hhhhhh....................hhhhhh.eeeeeeeeeeeeeee...............ee............eeeee.....eeeee........eee......eee........eee.............eeeeeee.............................hhhhhhhhhh.....eeeeeeeee.......eeeeee..ee.............eeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                1s5l o 2001 AKQTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA 2246
                                  2010      2020      2030      2040      2050      2060      2070      2080      2090      2100      2110      2120      2130      2140      2150      2160      2170      2180      2190      2200      2210      2220      2230      2240

Chain t from PDB  Type:PROTEIN  Length:31
 aligned with PSBT_THEEB | Q8DIQ0 from UniProtKB/Swiss-Prot  Length:32

    Alignment length:31
                                    10        20        30 
          PSBT_THEEB      1 METITYVFIFACIIALFFFAIFFREPPRITK   31
               SCOP domains ------------------------------- SCOP domains
               CATH domains ------------------------------- CATH domains
           Pfam domains (1) PsbT-1s5lt01 t:2001-2029     -- Pfam domains (1)
           Pfam domains (2) PsbT-1s5lt02 t:2001-2029     -- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------- PROSITE
                 Transcript ------------------------------- Transcript
                1s5l t 2001 METITYVFIFACIIALFFFAIFFREPPRITK 2031
                                  2010      2020      2030

Chain u from PDB  Type:PROTEIN  Length:105
 aligned with PSBU_THEEB | Q9F1L5 from UniProtKB/Swiss-Prot  Length:134

    Alignment length:105
                                    39        49        59        69        79        89        99       109       119       129     
          PSBU_THEEB     30 AATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  134
               SCOP domains --------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1s5lu01 u:2030-2123 Photosystem II 12 kDa extrinsic protein                                   ----------- CATH domains
           Pfam domains (1) -----------PsbU-1s5lu01 u:2041-2133                                                                     - Pfam domains (1)
           Pfam domains (2) -----------PsbU-1s5lu02 u:2041-2133                                                                     - Pfam domains (2)
         Sec.struct. author ..hhhhhhhhh.hhhhhh.......ee....hhhhhhhh...hhhhhhhhhhh....hhhhhhhh...hhhhhhhhhhhhh.ee....hhhhhh........... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------- Transcript
                1s5l u 2030 AATASTEEELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK 2134
                                  2039      2049      2059      2069      2079      2089      2099      2109      2119      2129

Chain v from PDB  Type:PROTEIN  Length:137
 aligned with CY550_THEEB | P0A386 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
         CY550_THEEB     27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 1s5lv00 v:2001-2137 Cytochrome c                                                                                                          CATH domains
           Pfam domains (1) -------------------------Cytochrom_C-1s5lv01 v:2026-2121                                                                 ---------------- Pfam domains (1)
           Pfam domains (2) -------------------------Cytochrom_C-1s5lv02 v:2026-2121                                                                 ---------------- Pfam domains (2)
         Sec.struct. author ...hhhhheee......eee.hhhhhhhhhhhhhhhhhhhhh............hhhhhhh......hhhhhhhhhhh........hhhhh..hhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: v:2024-2123 UniProt: 50-149                                                              -------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1s5l v 2001 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY 2137
                                  2010      2020      2030      2040      2050      2060      2070      2080      2090      2100      2110      2120      2130

Chain x from PDB  Type:PROTEIN  Length:40
 aligned with PSBX_THEEB | Q9F1R6 from UniProtKB/Swiss-Prot  Length:41

    Alignment length:40
                                    11        21        31        41
          PSBX_THEEB      2 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL   41
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains 1s5lx00 x:2011-2050 Single helix bin     CATH domains
           Pfam domains (1) -PsbX-1s5lx01 x:2012-2049              - Pfam domains (1)
           Pfam domains (2) -PsbX-1s5lx02 x:2012-2049              - Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------- PROSITE
                 Transcript ---------------------------------------- Transcript
                1s5l x 2011 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL 2050
                                  2020      2030      2040      2050

Chain z from PDB  Type:PROTEIN  Length:58
 aligned with PSBZ_THEEB | Q8DHJ2 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:58
                                    10        20        30        40        50        
          PSBZ_THEEB      1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLN   58
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains 1s5lz00 z:2001-2058 Helix hairpin bin                      CATH domains
           Pfam domains (1) ---Ycf9-1s5lz01 z:2004-2058                                Pfam domains (1)
           Pfam domains (2) ---Ycf9-1s5lz02 z:2004-2058                                Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                1s5l z 2001 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLN 2058
                                  2010      2020      2030      2040      2050

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (9, 18)

Pfam Domains (15, 34)

Gene Ontology (30, 185)

Asymmetric Unit(hide GO term definitions)

Chain A,a (PSBA1_THEEB | P0A444)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0010242	oxygen evolving activity	Catalysis of the reaction: 2 H2O = O2 + 4 H+ + 4 e-. The evolution of oxygen from oxidizing water is carried out by the oxygen evolving complex in photosystem II of plants. P680+, the photochemically oxidized reaction-center chlorophyll of PSII, is a strong biological oxidant. The reduction potential of P680+ is more positive than that of water, and thus it can oxidize water to give O2 and H+ ions. The oxygen escapes as a gas while the H+ ions remain in solution inside the thylakoid vesicle.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
	GO:0009635	response to herbicide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain B,b (PSBB_THEEB | Q8DIQ1)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009521	photosystem	A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain C,c (PSBC_THEEB | Q8DIF8)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009521	photosystem	A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain D,d (PSBD_THEEB | Q8CM25)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain E,e (PSBE_THEEB | Q8DIP0)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain F,f (PSBF_THEEB | Q8DIN9)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain H,h (PSBH_THEEB | Q8DJ43)

molecular function
	GO:0042301	phosphate ion binding	Interacting selectively and non-covalently with phosphate.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0050821	protein stabilization	Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain I,i (PSBI_THEEB | Q8DJZ6)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain J,j (PSBJ_THEEB | P59087)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain K,k (PSBK_THEEB | Q9F1K9)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain L,l (PSBL_THEEB | Q8DIN8)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain M,m (PSBM_THEEB | Q8DHA7)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain O,o (PSBO_THEEB | P0A431)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009654	photosystem II oxygen evolving complex	A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain T,t (PSBT_THEEB | Q8DIQ0)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain U,u (PSBU_THEEB | Q9F1L5)

biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009654	photosystem II oxygen evolving complex	A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain V,v (CY550_THEEB | P0A386)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0018063	cytochrome c-heme linkage	The linkage of cytochromes and other heme proteins to heme.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0022904	respiratory electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain X,x (PSBX_THEEB | Q9F1R6)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain Z,z (PSBZ_THEEB | Q8DHJ2)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (10, 182)

Sites (108, 108)

SS Bonds (2, 2)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 10)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (9, 18)

Pfam Domains (15, 34)

Gene Ontology (30, 185)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File