2AXT - JenaLib

Asymmetric Unit (146, 146)

No.	Name	Evidence	Residues	Description
001	AC1	SOFTWARE	ASP K:19 , ASP K:23 , UNK X:2	BINDING SITE FOR RESIDUE CA K 56
002	AC2	SOFTWARE	HIS A:215 , HIS A:272 , HIS D:214 , HIS D:268 , BCT D:353	BINDING SITE FOR RESIDUE FE2 A 557
003	AC3	SOFTWARE	HIS A:215 , GLU A:244 , TYR A:246 , HIS A:272 , FE2 A:557 , HIS D:214 , TYR D:244 , LYS D:264 , HIS D:268	BINDING SITE FOR RESIDUE BCT D 353
004	AC4	SOFTWARE	ASP k:5019 , ASP k:5023 , UNK x:5002	BINDING SITE FOR RESIDUE CA k 5056
005	AC5	SOFTWARE	HIS a:5215 , HIS a:5272 , HIS d:5214 , HIS d:5268 , BCT d:5353	BINDING SITE FOR RESIDUE FE2 a 5557
006	AC6	SOFTWARE	HIS a:5215 , GLU a:5244 , TYR a:5246 , HIS a:5272 , FE2 a:5557 , HIS d:5214 , TYR d:5244 , LYS d:5264 , HIS d:5268	BINDING SITE FOR RESIDUE BCT d 5353
007	AC7	SOFTWARE	PHE A:119 , TYR A:147 , PRO A:150 , SER A:153 , VAL A:157 , MET A:183 , ILE A:184 , PHE A:186 , GLN A:187 , LEU A:193 , HIS A:198 , GLY A:201 , VAL A:205 , THR A:286 , ILE A:290 , CLA A:559 , CLA A:560 , PHO A:561 , CLA D:354 , MGE D:360	BINDING SITE FOR RESIDUE CLA A 558
008	AC8	SOFTWARE	MET A:183 , PHE A:206 , CLA A:558 , CLA A:559 , CLA A:560 , PHO A:562 , VAL D:152 , VAL D:156 , PHE D:181 , LEU D:182 , PHE D:185 , GLN D:186 , TRP D:191 , THR D:192 , HIS D:197 , GLY D:200 , VAL D:201 , VAL D:204 , LEU D:279 , SER D:282 , ALA D:283 , VAL D:286 , MGE D:358	BINDING SITE FOR RESIDUE CLA D 354
009	AC9	SOFTWARE	THR A:45 , VAL A:157 , PHE A:158 , MET A:172 , ILE A:176 , THR A:179 , PHE A:180 , MET A:183 , CLA A:558 , PHO A:561 , UNK C:474 , MET D:198 , VAL D:201 , ALA D:202 , GLY D:206 , LEU D:209 , CLA D:354 , MGE L:210	BINDING SITE FOR RESIDUE CLA A 559
010	BC1	SOFTWARE	GLN A:199 , VAL A:202 , ALA A:203 , GLY A:207 , LEU A:210 , TRP A:278 , CLA A:558 , PHO A:562 , DGD C:509 , PHE D:157 , VAL D:175 , PHE D:179 , LEU D:182 , CLA D:354	BINDING SITE FOR RESIDUE CLA A 560
011	BC2	SOFTWARE	LEU A:41 , ALA A:44 , THR A:45 , ILE A:115 , PHE A:119 , TYR A:126 , GLN A:130 , TYR A:147 , PRO A:150 , PHE A:158 , LEU A:174 , PRO A:279 , VAL A:283 , CLA A:558 , CLA A:559 , LEU D:205 , ALA D:208 , LEU D:209 , ILE D:213 , TRP D:253 , PHE D:257	BINDING SITE FOR RESIDUE PHO A 561
012	BC3	SOFTWARE	PHE A:206 , ALA A:209 , LEU A:210 , ALA A:213 , MET A:214 , LEU A:258 , CLA A:560 , LEU D:37 , ALA D:41 , LEU D:45 , TRP D:48 , LEU D:122 , PHE D:125 , GLN D:129 , ASN D:142 , PHE D:146 , PRO D:149 , PHE D:153 , PRO D:275 , LEU D:279 , CLA D:354	BINDING SITE FOR RESIDUE PHO A 562
013	BC4	SOFTWARE	ILE A:36 , PRO A:39 , PHE A:93 , PRO A:95 , ILE A:96 , TRP A:97 , LEU A:114 , PHE A:117 , HIS A:118 , TYR I:9 , VAL I:12 , THR I:13 , PHE I:15 , MGE I:201	BINDING SITE FOR RESIDUE CLA A 563
014	BC5	SOFTWARE	UNK C:480 , LEU D:36 , PRO D:39 , LEU D:43 , LEU D:89 , LEU D:90 , LEU D:91 , LEU D:92 , TRP D:93 , THR D:112 , PHE D:113 , HIS D:117 , PHE D:120 , BCR D:357 , UNK X:63 , UNK X:64 , UNK X:67	BINDING SITE FOR RESIDUE CLA D 355
015	BC6	SOFTWARE	TRP B:185 , PHE B:190 , CLA B:512 , PHE H:41 , BCR H:107	BINDING SITE FOR RESIDUE CLA B 511
016	BC7	SOFTWARE	GLY B:189 , PHE B:190 , GLY B:197 , ALA B:200 , HIS B:201 , ALA B:204 , ALA B:205 , VAL B:208 , PHE B:247 , PHE B:250 , CLA B:511 , CLA B:513 , CLA B:518 , LEU D:158 , ILE D:159 , PHE H:38 , ILE H:45 , LEU H:46 , TYR H:49	BINDING SITE FOR RESIDUE CLA B 512
017	BC8	SOFTWARE	ARG B:68 , LEU B:69 , ALA B:146 , LEU B:149 , CYS B:150 , PHE B:153 , LEU B:158 , HIS B:201 , HIS B:202 , PHE B:247 , VAL B:252 , THR B:262 , CLA B:512 , CLA B:514 , CLA B:515 , CLA B:516 , PHE H:38 , LEU H:39	BINDING SITE FOR RESIDUE CLA B 513
018	BC9	SOFTWARE	TRP B:33 , PHE B:61 , PHE B:65 , ARG B:68 , LEU B:149 , VAL B:245 , ALA B:248 , ALA B:249 , VAL B:252 , PHE B:451 , HIS B:455 , PHE B:458 , PHE B:462 , CLA B:513 , CLA B:515 , CLA B:517 , CLA B:522 , CLA B:523 , CLA B:525	BINDING SITE FOR RESIDUE CLA B 514
019	CC1	SOFTWARE	THR B:27 , VAL B:30 , ALA B:31 , TRP B:33 , ALA B:34 , VAL B:62 , PHE B:65 , MET B:66 , ARG B:68 , LEU B:69 , VAL B:96 , HIS B:100 , GLY B:147 , ALA B:205 , CLA B:513 , CLA B:514 , CLA B:516 , CLA B:520	BINDING SITE FOR RESIDUE CLA B 515
020	CC2	SOFTWARE	LEU B:69 , GLY B:70 , TRP B:91 , ALA B:99 , HIS B:100 , LEU B:103 , GLY B:152 , PHE B:153 , PHE B:156 , HIS B:157 , PHE B:162 , GLY B:163 , PRO B:164 , CLA B:513 , CLA B:515 , BCR B:529	BINDING SITE FOR RESIDUE CLA B 516
021	CC3	SOFTWARE	TRP B:33 , TYR B:40 , GLN B:58 , GLY B:59 , PHE B:61 , LEU B:324 , PHE B:325 , THR B:327 , GLY B:328 , PRO B:329 , TRP B:450 , PHE B:451 , HIS B:455 , CLA B:514 , MGE B:530 , PHE D:196 , MET D:281 , LEU L:27 , PHE M:14 , BCR t:104	BINDING SITE FOR RESIDUE CLA B 517
022	CC4	SOFTWARE	THR B:236 , SER B:239 , ALA B:243 , PHE B:246 , PHE B:463 , HIS B:466 , LEU B:474 , CLA B:512 , CLA B:519 , CLA B:520 , UNK C:481 , UNK C:482 , ILE D:123 , MET D:126 , LEU D:127 , PHE D:130 , LEU H:43 , LEU H:46	BINDING SITE FOR RESIDUE CLA B 518
023	CC5	SOFTWARE	PHE B:139 , ALA B:212 , PHE B:215 , HIS B:216 , PRO B:221 , LEU B:229 , CLA B:518 , CLA B:520 , THR H:27 , THR H:28 , MET H:31 , PHE H:34 , BCR H:107	BINDING SITE FOR RESIDUE CLA B 519
024	CC6	SOFTWARE	LEU B:135 , PRO B:136 , PHE B:139 , HIS B:142 , MET B:231 , VAL B:237 , SER B:240 , SER B:241 , CLA B:515 , CLA B:518 , CLA B:519 , CLA B:522 , CLA B:525	BINDING SITE FOR RESIDUE CLA B 520
025	CC7	SOFTWARE	TRP B:5 , TYR B:6 , ARG B:7 , VAL B:8 , HIS B:9 , LEU B:238 , ILE B:242 , LEU B:461 , PHE B:462 , PHE B:464 , GLY B:465 , TRP B:468 , HIS B:469 , ARG B:472 , PHE B:479 , CLA B:522 , CLA B:523 , CLA B:524 , MGE D:359	BINDING SITE FOR RESIDUE CLA B 521
026	CC8	SOFTWARE	HIS B:9 , LEU B:12 , LEU B:19 , ALA B:22 , HIS B:23 , HIS B:26 , THR B:27 , VAL B:237 , LEU B:238 , SER B:241 , VAL B:245 , CLA B:514 , CLA B:520 , CLA B:521 , CLA B:523 , CLA B:525	BINDING SITE FOR RESIDUE CLA B 522
027	CC9	SOFTWARE	HIS B:9 , HIS B:26 , VAL B:30 , PHE B:462 , CLA B:514 , CLA B:521 , CLA B:522 , CLA B:524 , BCR B:527 , BCR B:528 , MGE D:359	BINDING SITE FOR RESIDUE CLA B 523
028	DC1	SOFTWARE	VAL B:8 , HIS B:9 , LEU B:12 , ALA B:22 , MET B:25 , LEU B:29 , TRP B:115 , CLA B:521 , CLA B:523 , BCR B:527 , ARG L:7 , VAL L:10 , MGE L:210 , UNK c:5475 , UNK c:5476	BINDING SITE FOR RESIDUE CLA B 524
029	DC2	SOFTWARE	ILE B:20 , HIS B:23 , MET B:138 , ILE B:141 , HIS B:142 , LEU B:145 , CLA B:514 , CLA B:520 , CLA B:522 , CLA B:526 , LEU H:14	BINDING SITE FOR RESIDUE CLA B 525
030	DC3	SOFTWARE	ILE B:20 , LEU B:24 , ALA B:110 , TRP B:113 , HIS B:114 , LEU B:120 , CLA B:525 , THR H:5 , LEU H:7	BINDING SITE FOR RESIDUE CLA B 526
031	DC4	SOFTWARE	LEU C:95 , LEU C:168 , GLY C:171 , ALA C:172 , ILE C:224 , VAL C:233 , HIS C:237 , ILE C:240 , ALA C:278 , MET C:281 , MET C:282 , VAL C:296 , TYR C:297 , CLA C:492 , CLA C:493 , BCR C:506	BINDING SITE FOR RESIDUE CLA C 491
032	DC5	SOFTWARE	TRP C:63 , HIS C:91 , GLY C:171 , LEU C:175 , LYS C:178 , ALA C:286 , TYR C:297 , HIS C:430 , LEU C:433 , PHE C:437 , CLA C:491 , CLA C:493 , CLA C:494 , CLA C:500	BINDING SITE FOR RESIDUE CLA C 492
033	DC6	SOFTWARE	ILE C:60 , VAL C:61 , ALA C:64 , THR C:68 , LEU C:88 , HIS C:91 , ILE C:92 , LEU C:95 , VAL C:114 , HIS C:118 , LEU C:279 , UNK C:477 , CLA C:491 , CLA C:492 , CLA C:500 , CLA C:502	BINDING SITE FOR RESIDUE CLA C 493
034	DC7	SOFTWARE	TRP C:63 , MET C:67 , PHE C:70 , GLY C:85 , ILE C:87 , SER C:406 , TRP C:425 , SER C:429 , HIS C:430 , UNK C:478 , CLA C:492 , CLA C:500 , DGD C:508 , PRO K:26	BINDING SITE FOR RESIDUE CLA C 494
035	DC8	SOFTWARE	ILE A:36 , SER A:124 , MET A:127 , TRP A:131 , ILE C:265 , TYR C:274 , GLY C:277 , ALA C:278 , LEU C:438 , HIS C:441 , LEU C:442 , ALA C:445 , ARG C:449 , CLA C:497 , PHE I:23	BINDING SITE FOR RESIDUE CLA C 495
036	DC9	SOFTWARE	LEU C:165 , ILE C:243 , GLY C:247 , TRP C:250 , HIS C:251 , PRO C:256 , PHE C:257 , TRP C:259 , PHE C:264 , CLA C:497 , BCR C:506 , LEU I:24	BINDING SITE FOR RESIDUE CLA C 496
037	EC1	SOFTWARE	MET C:157 , LEU C:161 , HIS C:164 , LEU C:168 , PHE C:264 , TRP C:266 , TYR C:271 , TYR C:274 , SER C:275 , LEU C:279 , MET C:282 , CLA C:495 , CLA C:496 , CLA C:499	BINDING SITE FOR RESIDUE CLA C 497
038	EC2	SOFTWARE	LHG A:567 , TRP C:36 , ALA C:37 , ASN C:39 , ALA C:40 , GLU C:269 , LEU C:276 , PHE C:436 , PHE C:437 , GLY C:440 , TRP C:443 , HIS C:444 , ARG C:447 , CLA C:499 , CLA C:500	BINDING SITE FOR RESIDUE CLA C 498
039	EC3	SOFTWARE	ASN C:39 , LEU C:49 , ALA C:52 , HIS C:53 , HIS C:56 , GLY C:268 , GLU C:269 , SER C:275 , CLA C:497 , CLA C:498 , CLA C:500	BINDING SITE FOR RESIDUE CLA C 499
040	EC4	SOFTWARE	ASN C:39 , HIS C:56 , LEU C:59 , LEU C:279 , PHE C:436 , PHE C:437 , CLA C:492 , CLA C:493 , CLA C:494 , CLA C:498 , CLA C:499 , CLA C:501 , PRO K:29 , VAL K:30 , LEU K:33	BINDING SITE FOR RESIDUE CLA C 500
041	EC5	SOFTWARE	ASP C:27 , TRP C:35 , GLY C:38 , ASN C:39 , ARG C:41 , LEU C:42 , LEU C:45 , LYS C:48 , ALA C:52 , PHE C:127 , ALA C:133 , ILE C:134 , CLA C:500 , BCR C:504 , TRP K:39 , GLN K:40 , UNK X:31 , VAL Z:20 , PRO Z:24	BINDING SITE FOR RESIDUE CLA C 501
042	EC6	SOFTWARE	HIS C:53 , PHE C:147 , PHE C:163 , HIS C:164 , VAL C:167 , LEU C:168 , GLY C:171 , CLA C:493 , CLA C:503 , BCR C:505	BINDING SITE FOR RESIDUE CLA C 502
043	EC7	SOFTWARE	LEU C:50 , GLY C:128 , TYR C:131 , HIS C:132 , PRO C:137 , LEU C:140 , PHE C:147 , CLA C:502 , BCR C:505	BINDING SITE FOR RESIDUE CLA C 503
044	EC8	SOFTWARE	ILE E:13 , ARG E:18 , TYR E:19 , HIS E:23 , THR E:26 , ILE E:27 , ARG F:19 , TRP F:20 , HIS F:24 , ALA F:27 , ILE F:31 , UNK X:116	BINDING SITE FOR RESIDUE HEM F 51
045	EC9	SOFTWARE	ALA V:62 , CYS V:63 , CYS V:66 , HIS V:67 , THR V:74 , LEU V:78 , ASP V:79 , LEU V:80 , THR V:84 , TYR V:101 , TYR V:108 , HIS V:118	BINDING SITE FOR RESIDUE HEM V 552
046	FC1	SOFTWARE	UNK C:474 , LEU D:209 , LEU D:210 , HIS D:214 , THR D:217 , ASN D:250 , TRP D:253 , ALA D:260 , PHE D:261 , LEU D:267 , PHE D:270 , VAL D:274	BINDING SITE FOR RESIDUE PQ9 D 356
047	FC2	SOFTWARE	HIS A:215 , LEU A:218 , ALA A:251 , HIS A:252 , PHE A:255 , SER A:264 , PHE A:265 , LEU A:271 , PHE A:274	BINDING SITE FOR RESIDUE PQ9 A 564
048	FC3	SOFTWARE	ASP A:170 , GLU A:189 , HIS A:332 , GLU A:333 , ASP A:342 , ALA A:344 , GLU C:354	BINDING SITE FOR RESIDUE OEC A 565
049	FC4	SOFTWARE	ILE A:38 , ALA A:43 , ALA A:51 , ALA A:54 , TRP A:105 , PHE I:15	BINDING SITE FOR RESIDUE BCR A 566
050	FC5	SOFTWARE	MET B:25 , LEU B:29 , TRP B:115 , CLA B:523 , CLA B:524 , BCR B:528 , MGE B:530 , ALA M:10 , BCR t:104 , PHE t:5019	BINDING SITE FOR RESIDUE BCR B 527
051	FC6	SOFTWARE	TRP B:33 , SER B:36 , MET B:37 , LEU B:109 , CLA B:517 , BCR B:527 , BCR B:528 , SQD a:212 , ILE t:5004 , PHE t:5008 , ALA t:5011 , PHE t:5018 , PHE t:5022	BINDING SITE FOR RESIDUE BCR t 104
052	FC7	SOFTWARE	LEU B:29 , GLY B:32 , TRP B:33 , SER B:36 , ILE B:101 , VAL B:102 , CLA B:523 , BCR B:527 , BCR t:104	BINDING SITE FOR RESIDUE BCR B 528
053	FC8	SOFTWARE	LEU B:106 , CYS B:112 , VAL B:116 , TYR B:117 , CLA B:516 , SQD a:212	BINDING SITE FOR RESIDUE BCR B 529
054	FC9	SOFTWARE	CLA B:511 , CLA B:519 , MET H:35 , PHE H:38 , PHE H:41 , UNK X:52 , UNK X:57	BINDING SITE FOR RESIDUE BCR H 107
055	GC1	SOFTWARE	TYR D:42 , LEU D:43 , GLY D:46 , GLY D:47 , LEU D:49 , THR D:50 , PHE D:113 , CLA D:355 , PRO F:29 , THR F:30 , PHE F:33 , ILE F:37 , VAL J:21 , VAL J:25	BINDING SITE FOR RESIDUE BCR D 357
056	GC2	SOFTWARE	BCR C:504 , ALA J:14 , THR J:15 , GLY J:18 , MET J:19 , LEU K:21 , LEU K:31 , ALA K:34 , PHE K:37 , VAL K:38 , UNK X:13 , UNK X:14 , UNK X:17 , VAL Z:13	BINDING SITE FOR RESIDUE BCR X 130
057	GC3	SOFTWARE	ALA C:55 , GLY C:58 , LEU C:59 , VAL C:116 , LEU C:119 , SER C:122 , ALA C:123 , GLY C:126 , CLA C:501 , BCR C:505 , TYR K:15 , PHE K:18 , PHE K:32 , ALA K:36 , BCR X:130	BINDING SITE FOR RESIDUE BCR C 504
058	GC4	SOFTWARE	PHE C:112 , VAL C:116 , ILE C:120 , SER C:121 , VAL C:124 , LEU C:125 , CLA C:502 , CLA C:503 , BCR C:504 , TYR K:15 , GLY Z:55	BINDING SITE FOR RESIDUE BCR C 505
059	GC5	SOFTWARE	ILE C:209 , TYR C:212 , LEU C:213 , ILE C:224 , VAL C:227 , ASP C:232 , VAL C:233 , HIS C:237 , PHE C:264 , CLA C:491 , CLA C:496 , VAL I:20 , PHE I:23 , LEU I:24	BINDING SITE FOR RESIDUE BCR C 506
060	GC6	SOFTWARE	PHE A:93 , TRP A:97 , LEU A:121 , CLA A:563 , SER C:216 , PHE C:218 , TRP C:223 , MET C:281 , PHE C:284 , LYS I:5 , TYR I:9	BINDING SITE FOR RESIDUE MGE I 201
061	GC7	SOFTWARE	PHE A:155 , ILE A:160 , ILE A:163 , PRO C:217 , PHE C:218 , GLY C:219 , GLY C:220 , GLY C:222 , VAL C:225 , SER C:226 , ASN C:228 , PHE C:284 , CYS C:288 , PHE C:292 , ASN C:294 , ARG C:362 , LEU C:438	BINDING SITE FOR RESIDUE DGD C 507
062	GC8	SOFTWARE	ARG A:140 , TRP A:142 , PHE A:273 , SQD A:568 , TRP C:36 , PHE C:436 , TRP C:443 , ARG C:447 , CLA C:498 , GLU D:219 , ASN D:220 , ALA D:229 , SER D:230 , THR D:231 , PHE D:232	BINDING SITE FOR RESIDUE LHG A 567
063	GC9	SOFTWARE	ASN A:267 , SER A:270 , PHE A:273 , PHE A:274 , LHG A:567 , GLU C:29 , TRP C:36 , SER D:230 , PHE D:232 , ARG D:233	BINDING SITE FOR RESIDUE SQD A 568
064	HC1	SOFTWARE	PHE A:197 , GLU C:83 , GLN C:84 , GLY C:85 , SER C:406 , ASN C:418 , PHE C:419 , VAL C:420 , TRP C:425 , THR C:428 , UNK C:479 , CLA C:494 , DGD C:509 , TYR J:33	BINDING SITE FOR RESIDUE DGD C 508
065	HC2	SOFTWARE	GLN A:199 , LEU A:200 , PHE A:300 , ASN A:301 , PHE A:302 , SER A:305 , CLA A:560 , ASN C:405 , ASN C:415 , SER C:416 , ASN C:418 , DGD C:508 , MGE D:358 , PHE J:29 , ALA J:32 , TYR J:33 , GLY J:37 , SER J:38 , SER J:39 , GLN V:60	BINDING SITE FOR RESIDUE DGD C 509
066	HC3	SOFTWARE	DGD C:509 , TYR D:67 , GLY D:70 , CYS D:71 , CLA D:354 , THR F:30 , MET F:40 , GLN F:41 , GLY J:31 , ALA J:32 , GLY J:35 , GLY J:37	BINDING SITE FOR RESIDUE MGE D 358
067	HC4	SOFTWARE	TYR B:193 , PHE B:250 , TYR B:258 , TYR B:273 , SER B:277 , PHE B:463 , HIS D:87 , ILE D:123 , LEU D:162 , SER D:165 , TYR H:49 , VAL H:60 , SER H:61 , TRP H:62	BINDING SITE FOR RESIDUE DGD H 208
068	HC5	SOFTWARE	ASN A:234 , TRP B:5 , TYR B:6 , ARG B:7 , PHE B:464 , TRP B:468 , CLA B:521 , CLA B:523 , ARG D:139 , TYR D:141 , PHE D:269 , PHE D:273 , MGE L:210	BINDING SITE FOR RESIDUE MGE D 359
069	HC6	SOFTWARE	SER A:232 , ASN A:234 , CLA A:559 , TRP B:5 , TYR B:6 , CLA B:524 , UNK C:474 , TRP D:266 , PHE D:270 , PHE D:273 , MGE D:359 , GLU L:11 , SER L:16 , GLY L:20	BINDING SITE FOR RESIDUE MGE L 210
070	HC7	SOFTWARE	CLA A:558 , ILE D:259 , ALA D:260 , PHE D:261 , SER D:262 , ASN D:263 , TRP D:266 , PHE D:270 , THR L:15 , TYR L:18 , LEU L:19 , PHE T:10 , PHE T:17 , ALA T:20	BINDING SITE FOR RESIDUE MGE D 360
071	HC8	SOFTWARE	TRP B:113 , TYR B:117 , BCR B:529 , TRP a:5020 , ASN a:5026 , ARG a:5027 , LEU a:5028 , BCR t:104	BINDING SITE FOR RESIDUE SQD a 212
072	HC9	SOFTWARE	ARG B:18 , LEU B:29 , SER B:104 , ARG l:5014 , TYR l:5018 , PHE t:5019 , PHE t:5023	BINDING SITE FOR RESIDUE SQD t 213
073	IC1	SOFTWARE	THR B:327 , GLY B:328 , PRO B:329 , PHE B:453 , CLA B:517 , BCR B:527 , PHE L:35 , ASN M:4 , LEU M:6 , LMT M:5216	BINDING SITE FOR RESIDUE MGE B 530
074	IC2	SOFTWARE	ILE A:50 , LEU A:72 , TYR A:73 , UNK C:488 , UNK C:489 , ARG D:304 , GLY O:139 , GLU O:140 , LMT T:217 , ALA b:5043 , LEU b:5098	BINDING SITE FOR RESIDUE LMT A 569
075	IC3	SOFTWARE	MET M:1 , LMT M:5216 , MET T:1 , ILE T:4 , LMT T:217 , TYR b:5040 , MGE b:5530 , GLN m:5005 , LEU m:5006	BINDING SITE FOR RESIDUE LMT m 216
076	IC4	SOFTWARE	LEU A:72 , LMT A:569 , MET T:1 , ILE T:4 , ALA T:11 , ILE T:14 , TYR b:5040 , ALA b:5043 , THR b:5044 , BCR b:5528 , LMT m:216	BINDING SITE FOR RESIDUE LMT T 217
077	IC5	SOFTWARE	PHE a:5119 , TYR a:5147 , PRO a:5150 , SER a:5153 , VAL a:5157 , MET a:5183 , ILE a:5184 , PHE a:5186 , GLN a:5187 , LEU a:5193 , HIS a:5198 , GLY a:5201 , VAL a:5205 , THR a:5286 , ILE a:5290 , CLA a:5559 , CLA a:5560 , PHO a:5561 , LEU d:5182 , CLA d:5354 , MGE d:5361	BINDING SITE FOR RESIDUE CLA a 5558
078	IC6	SOFTWARE	MET a:5183 , PHE a:5206 , CLA a:5558 , CLA a:5559 , CLA a:5560 , PHO a:5562 , VAL d:5152 , VAL d:5156 , PHE d:5181 , LEU d:5182 , PHE d:5185 , GLN d:5186 , TRP d:5191 , THR d:5192 , HIS d:5197 , GLY d:5200 , VAL d:5201 , VAL d:5204 , LEU d:5279 , SER d:5282 , ALA d:5283 , VAL d:5286 , MGE d:5359	BINDING SITE FOR RESIDUE CLA d 5354
079	IC7	SOFTWARE	THR a:5045 , VAL a:5157 , PHE a:5158 , MET a:5172 , ILE a:5176 , THR a:5179 , PHE a:5180 , MET a:5183 , CLA a:5558 , UNK c:5474 , MET d:5198 , VAL d:5201 , ALA d:5202 , GLY d:5206 , LEU d:5209 , CLA d:5354 , MGE d:5361 , MGE l:5210	BINDING SITE FOR RESIDUE CLA a 5559
080	IC8	SOFTWARE	GLN a:5199 , VAL a:5202 , ALA a:5203 , GLY a:5207 , LEU a:5210 , TRP a:5278 , CLA a:5558 , PHO a:5562 , DGD c:5509 , PHE d:5157 , VAL d:5175 , PHE d:5179 , LEU d:5182 , CLA d:5354 , MGE d:5359	BINDING SITE FOR RESIDUE CLA a 5560
081	IC9	SOFTWARE	LEU a:5041 , ALA a:5044 , THR a:5045 , ILE a:5115 , PHE a:5119 , TYR a:5126 , GLN a:5130 , TYR a:5147 , PRO a:5150 , PHE a:5158 , LEU a:5174 , PRO a:5279 , VAL a:5283 , CLA a:5558 , LEU d:5205 , ALA d:5208 , LEU d:5209 , ILE d:5213 , TRP d:5253 , PHE d:5257	BINDING SITE FOR RESIDUE PHO a 5561
082	JC1	SOFTWARE	PHE a:5206 , ALA a:5209 , LEU a:5210 , ALA a:5213 , MET a:5214 , LEU a:5258 , CLA a:5560 , LEU d:5037 , ALA d:5041 , LEU d:5045 , TRP d:5048 , GLY d:5118 , LEU d:5122 , PHE d:5125 , GLN d:5129 , ASN d:5142 , PHE d:5146 , PRO d:5149 , PHE d:5153 , PRO d:5275 , LEU d:5279 , CLA d:5354	BINDING SITE FOR RESIDUE PHO a 5562
083	JC2	SOFTWARE	ILE a:5036 , PRO a:5039 , THR a:5040 , PHE a:5093 , PRO a:5095 , ILE a:5096 , TRP a:5097 , LEU a:5114 , PHE a:5117 , HIS a:5118 , LEU a:5121 , TYR i:5009 , THR i:5013 , PHE i:5015 , MGE i:5201	BINDING SITE FOR RESIDUE CLA a 5563
084	JC3	SOFTWARE	UNK c:5480 , LEU d:5036 , PRO d:5039 , LEU d:5043 , LEU d:5089 , LEU d:5090 , LEU d:5091 , LEU d:5092 , TRP d:5093 , THR d:5112 , PHE d:5113 , HIS d:5117 , PHE d:5120 , BCR d:5357 , UNK x:5063 , UNK x:5064	BINDING SITE FOR RESIDUE CLA d 5355
085	JC4	SOFTWARE	TRP b:5185 , PHE b:5190 , CLA b:5512 , PHE h:5041 , BCR h:5107	BINDING SITE FOR RESIDUE CLA b 5511
086	JC5	SOFTWARE	GLY b:5189 , PHE b:5190 , GLY b:5197 , ALA b:5200 , HIS b:5201 , ALA b:5204 , ALA b:5205 , VAL b:5208 , PHE b:5247 , PHE b:5250 , CLA b:5511 , CLA b:5513 , CLA b:5518 , LEU d:5158 , ILE d:5159 , PHE h:5038 , PHE h:5041 , ILE h:5045 , LEU h:5046 , TYR h:5049	BINDING SITE FOR RESIDUE CLA b 5512
087	JC6	SOFTWARE	ARG b:5068 , LEU b:5069 , ALA b:5146 , LEU b:5149 , CYS b:5150 , PHE b:5153 , LEU b:5158 , HIS b:5201 , HIS b:5202 , PHE b:5247 , VAL b:5252 , THR b:5262 , CLA b:5512 , CLA b:5514 , CLA b:5515 , CLA b:5516 , CLA b:5520 , PHE h:5038 , LEU h:5039	BINDING SITE FOR RESIDUE CLA b 5513
088	JC7	SOFTWARE	TRP b:5033 , PHE b:5061 , PHE b:5065 , ARG b:5068 , LEU b:5148 , VAL b:5245 , ALA b:5248 , ALA b:5249 , VAL b:5252 , PHE b:5451 , HIS b:5455 , PHE b:5458 , PHE b:5462 , CLA b:5513 , CLA b:5515 , CLA b:5517 , CLA b:5522 , CLA b:5523 , CLA b:5525	BINDING SITE FOR RESIDUE CLA b 5514
089	JC8	SOFTWARE	THR b:5027 , VAL b:5030 , ALA b:5031 , TRP b:5033 , ALA b:5034 , VAL b:5062 , PHE b:5065 , MET b:5066 , ARG b:5068 , LEU b:5069 , HIS b:5100 , GLY b:5147 , ALA b:5205 , CLA b:5513 , CLA b:5514 , CLA b:5516 , CLA b:5520	BINDING SITE FOR RESIDUE CLA b 5515
090	JC9	SOFTWARE	LEU b:5069 , GLY b:5070 , TRP b:5091 , ALA b:5099 , HIS b:5100 , LEU b:5103 , GLY b:5152 , PHE b:5153 , PHE b:5156 , HIS b:5157 , PHE b:5162 , GLY b:5163 , PRO b:5164 , CLA b:5513 , CLA b:5515 , BCR b:5529	BINDING SITE FOR RESIDUE CLA b 5516
091	KC1	SOFTWARE	BCR T:5104 , TRP b:5033 , TYR b:5040 , GLN b:5058 , GLY b:5059 , PHE b:5061 , LEU b:5324 , PHE b:5325 , THR b:5327 , GLY b:5328 , PRO b:5329 , TRP b:5450 , PHE b:5451 , HIS b:5455 , CLA b:5514 , MGE b:5530 , PHE d:5196 , MET d:5281 , LEU l:5027 , PHE m:5014	BINDING SITE FOR RESIDUE CLA b 5517
092	KC2	SOFTWARE	THR b:5236 , SER b:5239 , ALA b:5243 , PHE b:5246 , PHE b:5463 , HIS b:5466 , LEU b:5474 , CLA b:5512 , CLA b:5519 , CLA b:5520 , UNK c:5481 , UNK c:5482 , ILE d:5123 , MET d:5126 , LEU d:5127 , PHE d:5130 , LEU h:5043 , LEU h:5046	BINDING SITE FOR RESIDUE CLA b 5518
093	KC3	SOFTWARE	PHE b:5139 , ALA b:5212 , PHE b:5215 , HIS b:5216 , PRO b:5221 , LEU b:5229 , CLA b:5518 , CLA b:5520 , THR h:5027 , THR h:5028 , MET h:5031 , PHE h:5034 , BCR h:5107	BINDING SITE FOR RESIDUE CLA b 5519
094	KC4	SOFTWARE	LEU b:5135 , PRO b:5136 , PHE b:5139 , HIS b:5142 , MET b:5231 , VAL b:5237 , SER b:5240 , CLA b:5513 , CLA b:5515 , CLA b:5518 , CLA b:5519 , CLA b:5522 , CLA b:5525	BINDING SITE FOR RESIDUE CLA b 5520
095	KC5	SOFTWARE	TRP b:5005 , TYR b:5006 , ARG b:5007 , VAL b:5008 , HIS b:5009 , LEU b:5238 , ILE b:5242 , LEU b:5461 , PHE b:5462 , PHE b:5464 , GLY b:5465 , TRP b:5468 , HIS b:5469 , ARG b:5472 , PHE b:5479 , CLA b:5522 , CLA b:5523 , CLA b:5524 , MGE d:5360	BINDING SITE FOR RESIDUE CLA b 5521
096	KC6	SOFTWARE	HIS b:5009 , LEU b:5012 , LEU b:5019 , ALA b:5022 , HIS b:5023 , HIS b:5026 , THR b:5027 , VAL b:5237 , LEU b:5238 , SER b:5241 , VAL b:5245 , CLA b:5514 , CLA b:5520 , CLA b:5521 , CLA b:5523 , CLA b:5525	BINDING SITE FOR RESIDUE CLA b 5522
097	KC7	SOFTWARE	HIS b:5009 , HIS b:5026 , VAL b:5030 , PHE b:5462 , CLA b:5514 , CLA b:5521 , CLA b:5522 , CLA b:5524 , BCR b:5527 , BCR b:5528 , MGE d:5360	BINDING SITE FOR RESIDUE CLA b 5523
098	KC8	SOFTWARE	UNK C:475 , UNK C:476 , VAL b:5008 , HIS b:5009 , LEU b:5012 , ALA b:5022 , LEU b:5029 , TRP b:5115 , CLA b:5521 , CLA b:5523 , BCR b:5527 , ARG l:5007 , VAL l:5010 , MGE l:5210 , PHE m:5021	BINDING SITE FOR RESIDUE CLA b 5524
099	KC9	SOFTWARE	ILE b:5020 , HIS b:5023 , MET b:5138 , ILE b:5141 , HIS b:5142 , LEU b:5145 , CLA b:5514 , CLA b:5520 , CLA b:5522 , CLA b:5526 , LEU h:5014	BINDING SITE FOR RESIDUE CLA b 5525
100	LC1	SOFTWARE	ILE b:5020 , LEU b:5024 , ALA b:5110 , TRP b:5113 , HIS b:5114 , LEU b:5120 , CLA b:5525 , THR h:5005 , LEU h:5007	BINDING SITE FOR RESIDUE CLA b 5526
101	LC2	SOFTWARE	LEU c:5095 , LEU c:5168 , GLY c:5171 , ALA c:5172 , VAL c:5233 , HIS c:5237 , ILE c:5240 , ALA c:5278 , MET c:5281 , VAL c:5296 , TYR c:5297 , CLA c:5492 , CLA c:5493 , BCR c:5506	BINDING SITE FOR RESIDUE CLA c 5491
102	LC3	SOFTWARE	TRP c:5063 , HIS c:5091 , TRP c:5097 , GLY c:5171 , LYS c:5178 , ALA c:5286 , TYR c:5297 , HIS c:5430 , LEU c:5433 , PHE c:5437 , CLA c:5491 , CLA c:5493 , CLA c:5494 , CLA c:5500	BINDING SITE FOR RESIDUE CLA c 5492
103	LC4	SOFTWARE	ILE c:5060 , VAL c:5061 , ALA c:5064 , THR c:5068 , LEU c:5088 , HIS c:5091 , ILE c:5092 , LEU c:5095 , VAL c:5114 , HIS c:5118 , LEU c:5279 , UNK c:5477 , CLA c:5491 , CLA c:5492 , CLA c:5500 , CLA c:5502	BINDING SITE FOR RESIDUE CLA c 5493
104	LC5	SOFTWARE	TRP c:5063 , MET c:5067 , PHE c:5070 , GLY c:5085 , ILE c:5087 , SER c:5406 , TRP c:5425 , SER c:5429 , HIS c:5430 , UNK c:5478 , CLA c:5492 , CLA c:5500 , DGD c:5508 , PRO k:5026	BINDING SITE FOR RESIDUE CLA c 5494
105	LC6	SOFTWARE	ILE a:5036 , SER a:5124 , MET a:5127 , TRP a:5131 , ILE c:5265 , TYR c:5274 , GLY c:5277 , ALA c:5278 , LEU c:5438 , HIS c:5441 , LEU c:5442 , ALA c:5445 , ARG c:5449 , CLA c:5497 , PHE i:5023	BINDING SITE FOR RESIDUE CLA c 5495
106	LC7	SOFTWARE	LEU c:5165 , ILE c:5243 , GLY c:5247 , TRP c:5250 , HIS c:5251 , PRO c:5256 , PHE c:5257 , TRP c:5259 , PHE c:5264 , CLA c:5497 , BCR c:5506 , LEU i:5024	BINDING SITE FOR RESIDUE CLA c 5496
107	LC8	SOFTWARE	MET c:5157 , LEU c:5161 , HIS c:5164 , LEU c:5168 , PHE c:5264 , TRP c:5266 , TYR c:5271 , TYR c:5274 , SER c:5275 , LEU c:5279 , MET c:5282 , CLA c:5495 , CLA c:5496 , CLA c:5499	BINDING SITE FOR RESIDUE CLA c 5497
108	LC9	SOFTWARE	LHG a:5567 , TRP c:5036 , ALA c:5037 , ASN c:5039 , ALA c:5040 , GLU c:5269 , LEU c:5272 , LEU c:5276 , PHE c:5436 , PHE c:5437 , GLY c:5440 , TRP c:5443 , HIS c:5444 , ARG c:5447 , CLA c:5499 , CLA c:5500	BINDING SITE FOR RESIDUE CLA c 5498
109	MC1	SOFTWARE	ASN c:5039 , LEU c:5049 , ALA c:5052 , HIS c:5053 , HIS c:5056 , GLU c:5269 , LEU c:5272 , SER c:5275 , CLA c:5497 , CLA c:5498 , CLA c:5500	BINDING SITE FOR RESIDUE CLA c 5499
110	MC2	SOFTWARE	ASN c:5039 , HIS c:5056 , LEU c:5059 , LEU c:5279 , PHE c:5436 , PHE c:5437 , CLA c:5492 , CLA c:5493 , CLA c:5494 , CLA c:5498 , CLA c:5499 , PRO k:5029 , VAL k:5030 , LEU k:5033	BINDING SITE FOR RESIDUE CLA c 5500
111	MC3	SOFTWARE	ASP c:5027 , TRP c:5035 , GLY c:5038 , ASN c:5039 , ARG c:5041 , LEU c:5042 , LEU c:5045 , LYS c:5048 , ALA c:5052 , PHE c:5127 , ALA c:5133 , ILE c:5134 , BCR c:5504 , TRP k:5039 , GLN k:5040 , UNK x:5031 , VAL z:5020 , PRO z:5024	BINDING SITE FOR RESIDUE CLA c 5501
112	MC4	SOFTWARE	HIS c:5053 , PHE c:5147 , PHE c:5163 , HIS c:5164 , VAL c:5167 , LEU c:5168 , GLY c:5171 , CLA c:5493 , CLA c:5503 , BCR c:5505	BINDING SITE FOR RESIDUE CLA c 5502
113	MC5	SOFTWARE	LEU c:5050 , VAL c:5124 , GLY c:5128 , TYR c:5131 , HIS c:5132 , PRO c:5137 , LEU c:5140 , PHE c:5147 , CLA c:5502 , BCR c:5505	BINDING SITE FOR RESIDUE CLA c 5503
114	MC6	SOFTWARE	ILE e:5013 , ARG e:5018 , TYR e:5019 , HIS e:5023 , THR e:5026 , ILE e:5027 , ARG f:5019 , TRP f:5020 , HIS f:5024 , ALA f:5027 , ILE f:5031 , UNK x:5116	BINDING SITE FOR RESIDUE HEM f 5051
115	MC7	SOFTWARE	ALA v:5062 , CYS v:5063 , CYS v:5066 , HIS v:5067 , THR v:5074 , LEU v:5078 , ASP v:5079 , LEU v:5080 , THR v:5084 , TYR v:5101 , TYR v:5108 , HIS v:5118	BINDING SITE FOR RESIDUE HEM v 5552
116	MC8	SOFTWARE	UNK c:5474 , LEU d:5209 , LEU d:5210 , HIS d:5214 , THR d:5217 , TRP d:5253 , ALA d:5260 , PHE d:5261 , LEU d:5267 , PHE d:5270 , VAL d:5274 , THR d:5277	BINDING SITE FOR RESIDUE PQ9 d 5356
117	MC9	SOFTWARE	HIS a:5215 , LEU a:5218 , ALA a:5251 , HIS a:5252 , PHE a:5255 , SER a:5264 , PHE a:5265 , LEU a:5271 , PHE a:5274	BINDING SITE FOR RESIDUE PQ9 a 5564
118	NC1	SOFTWARE	ASP a:5170 , GLU a:5189 , HIS a:5332 , GLU a:5333 , ASP a:5342 , ALA a:5344 , GLU c:5354	BINDING SITE FOR RESIDUE OEC a 5565
119	NC2	SOFTWARE	ILE a:5038 , ALA a:5043 , ALA a:5051 , ALA a:5054 , TRP a:5105 , PHE i:5015	BINDING SITE FOR RESIDUE BCR a 5566
120	NC3	SOFTWARE	PHE T:19 , BCR T:5104 , MET b:5025 , LEU b:5029 , TRP b:5115 , CLA b:5523 , CLA b:5524 , BCR b:5528 , MGE b:5530	BINDING SITE FOR RESIDUE BCR b 5527
121	NC4	SOFTWARE	SQD A:5212 , ILE T:4 , PHE T:8 , ALA T:11 , ALA T:15 , PHE T:17 , PHE T:18 , ILE T:21 , PHE T:22 , TRP b:5033 , SER b:5036 , MET b:5037 , LEU b:5109 , CLA b:5517 , BCR b:5527 , BCR b:5528	BINDING SITE FOR RESIDUE BCR T 5104
122	NC5	SOFTWARE	LMT T:217 , BCR T:5104 , LEU b:5029 , GLY b:5032 , TRP b:5033 , SER b:5036 , ILE b:5101 , VAL b:5102 , CLA b:5523 , BCR b:5527	BINDING SITE FOR RESIDUE BCR b 5528
123	NC6	SOFTWARE	SQD A:5212 , PHE T:18 , PHE T:22 , LEU b:5106 , CYS b:5112 , VAL b:5116 , TYR b:5117 , CLA b:5516	BINDING SITE FOR RESIDUE BCR b 5529
124	NC7	SOFTWARE	CLA b:5511 , CLA b:5519 , PHE h:5038 , PHE h:5041 , UNK x:5052 , UNK x:5057	BINDING SITE FOR RESIDUE BCR h 5107
125	NC8	SOFTWARE	TYR d:5042 , LEU d:5043 , GLY d:5046 , GLY d:5047 , LEU d:5049 , THR d:5050 , PHE d:5101 , PHE d:5113 , CLA d:5355 , PRO f:5029 , THR f:5030 , PHE f:5033 , ILE f:5037 , VAL j:5021 , VAL j:5025	BINDING SITE FOR RESIDUE BCR d 5357
126	NC9	SOFTWARE	BCR c:5504 , ALA j:5014 , THR j:5015 , GLY j:5018 , MET j:5019 , LEU k:5021 , LEU k:5031 , ALA k:5034 , PHE k:5037 , VAL k:5038 , UNK x:5013 , UNK x:5014 , UNK x:5017 , VAL z:5013	BINDING SITE FOR RESIDUE BCR x 5130
127	OC1	SOFTWARE	ALA c:5055 , GLY c:5058 , LEU c:5059 , VAL c:5116 , LEU c:5119 , SER c:5122 , ALA c:5123 , CLA c:5501 , BCR c:5505 , TYR k:5015 , PHE k:5018 , PHE k:5032 , ALA k:5036 , BCR x:5130	BINDING SITE FOR RESIDUE BCR c 5504
128	OC2	SOFTWARE	PHE c:5112 , VAL c:5116 , ILE c:5120 , SER c:5121 , VAL c:5124 , LEU c:5125 , CLA c:5502 , CLA c:5503 , BCR c:5504 , TYR k:5015 , GLY z:5055	BINDING SITE FOR RESIDUE BCR c 5505
129	OC3	SOFTWARE	ILE c:5209 , TYR c:5212 , ILE c:5224 , VAL c:5227 , ASP c:5232 , HIS c:5237 , PHE c:5264 , CLA c:5491 , CLA c:5496 , VAL i:5020 , PHE i:5023 , LEU i:5024	BINDING SITE FOR RESIDUE BCR c 5506
130	OC4	SOFTWARE	PHE a:5093 , TRP a:5097 , LEU a:5121 , CLA a:5563 , SER c:5216 , PHE c:5218 , TRP c:5223 , MET c:5281 , PHE c:5284 , LYS i:5005 , TYR i:5009	BINDING SITE FOR RESIDUE MGE i 5201
131	OC5	SOFTWARE	PHE a:5155 , ILE a:5160 , ILE a:5163 , PRO c:5217 , PHE c:5218 , GLY c:5219 , GLY c:5220 , GLY c:5222 , VAL c:5225 , SER c:5226 , ASN c:5228 , PHE c:5284 , CYS c:5288 , PHE c:5292 , ASN c:5294 , ARG c:5362 , LEU c:5438	BINDING SITE FOR RESIDUE DGD c 5507
132	OC6	SOFTWARE	ARG a:5140 , TRP a:5142 , PHE a:5273 , TRP c:5036 , PHE c:5436 , TRP c:5443 , ARG c:5447 , CLA c:5498 , GLU d:5219 , ASN d:5220 , ALA d:5229 , SER d:5230 , THR d:5231 , PHE d:5232 , SQD d:5358	BINDING SITE FOR RESIDUE LHG a 5567
133	OC7	SOFTWARE	ASN a:5267 , SER a:5270 , PHE a:5274 , LHG a:5567 , GLU c:5029 , TRP c:5036 , SER d:5230 , PHE d:5232 , ARG d:5233	BINDING SITE FOR RESIDUE SQD d 5358
134	OC8	SOFTWARE	PHE a:5197 , GLU c:5083 , GLN c:5084 , GLY c:5085 , SER c:5406 , ASN c:5418 , PHE c:5419 , VAL c:5420 , TRP c:5425 , THR c:5428 , UNK c:5479 , CLA c:5494 , DGD c:5509 , TYR j:5033	BINDING SITE FOR RESIDUE DGD c 5508
135	OC9	SOFTWARE	GLN a:5199 , LEU a:5200 , PHE a:5300 , ASN a:5301 , SER a:5305 , CLA a:5560 , ASN c:5405 , VAL c:5407 , ASN c:5415 , SER c:5416 , ASN c:5418 , DGD c:5508 , MGE d:5359 , PHE j:5029 , ALA j:5032 , TYR j:5033 , GLY j:5037 , SER j:5038 , SER j:5039 , GLN v:5060	BINDING SITE FOR RESIDUE DGD c 5509
136	PC1	SOFTWARE	CLA a:5560 , DGD c:5509 , TYR d:5067 , GLY d:5070 , CYS d:5071 , PHE d:5073 , CLA d:5354 , THR f:5030 , GLN f:5041 , GLY j:5031 , ALA j:5032 , GLY j:5037	BINDING SITE FOR RESIDUE MGE d 5359
137	PC2	SOFTWARE	TYR b:5193 , PHE b:5250 , TYR b:5258 , TYR b:5273 , SER b:5277 , PHE b:5463 , HIS d:5087 , ILE d:5123 , LEU d:5162 , SER d:5165 , TYR h:5049 , VAL h:5060 , SER h:5061 , TRP h:5062	BINDING SITE FOR RESIDUE DGD h 5208
138	PC3	SOFTWARE	TRP b:5005 , TYR b:5006 , ARG b:5007 , PHE b:5464 , TRP b:5468 , CLA b:5521 , CLA b:5523 , ARG d:5139 , TYR d:5141 , PHE d:5269 , PHE d:5273 , MGE l:5210	BINDING SITE FOR RESIDUE MGE d 5360
139	PC4	SOFTWARE	SER a:5232 , ASN a:5234 , CLA a:5559 , TRP b:5005 , TYR b:5006 , CLA b:5524 , UNK c:5474 , TRP d:5266 , PHE d:5270 , PHE d:5273 , MGE d:5360 , GLU l:5011 , SER l:5016 , GLY l:5020	BINDING SITE FOR RESIDUE MGE l 5210
140	PC5	SOFTWARE	CLA a:5558 , CLA a:5559 , ILE d:5259 , ALA d:5260 , PHE d:5261 , SER d:5262 , ASN d:5263 , TRP d:5266 , PHE d:5270 , ASN l:5013 , THR l:5015 , TYR l:5018 , LEU l:5019 , PHE t:5010 , PHE t:5017 , ALA t:5020	BINDING SITE FOR RESIDUE MGE d 5361
141	PC6	SOFTWARE	TRP A:20 , ASN A:26 , ARG A:27 , LEU A:28 , BCR T:5104 , TRP b:5113 , TYR b:5117 , BCR b:5529	BINDING SITE FOR RESIDUE SQD A 5212
142	PC7	SOFTWARE	ARG L:14 , TYR L:18 , LEU L:21 , PHE T:19 , PHE T:23 , ARG b:5018 , LEU b:5029 , SER b:5104	BINDING SITE FOR RESIDUE SQD L 5213
143	PC8	SOFTWARE	THR b:5327 , GLY b:5328 , PRO b:5329 , LYS b:5332 , PHE b:5453 , CLA b:5517 , BCR b:5527 , PHE l:5035 , LMT m:216 , ASN m:5004 , LEU m:5006	BINDING SITE FOR RESIDUE MGE b 5530
144	PC9	SOFTWARE	ALA B:43 , LEU B:98 , ILE a:5050 , LEU a:5072 , TYR a:5073 , UNK c:5488 , UNK c:5489 , ARG d:5304 , GLY o:5139 , GLU o:5140 , LMT t:5217	BINDING SITE FOR RESIDUE LMT a 5568
145	QC1	SOFTWARE	TYR B:40 , MGE B:530 , GLN M:5 , LEU M:6 , LMT m:216 , MET m:5001 , MET t:5001 , ILE t:5004 , LMT t:5217	BINDING SITE FOR RESIDUE LMT M 5216
146	QC2	SOFTWARE	TYR B:40 , ALA B:43 , THR B:44 , LMT M:5216 , LEU a:5072 , LMT a:5568 , MET t:5001 , ILE t:5004	BINDING SITE FOR RESIDUE LMT t 5217

SS Bonds (2, 2)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 10)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:335
 aligned with PSBA1_SYNEL | P0A445 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:335
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     
         PSBA1_SYNEL     10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
               SCOP domains d2axta1 A:10-344 Photosystem Q(B) protein 1, PsbA1                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh...............hhhhh....................hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhh.........hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt A   10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339

Chain A from PDB  Type:PROTEIN  Length:335
 aligned with PSBA1_THEEB | P0A444 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:335
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     
         PSBA1_THEEB     10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
               SCOP domains d2axta1 A:10-344 Photosystem Q(B) protein 1, PsbA1                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh...............hhhhh....................hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhh.........hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt A   10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339

Chain B from PDB  Type:PROTEIN  Length:488
 aligned with PSBB_THEEB | Q8DIQ1 from UniProtKB/Swiss-Prot  Length:510

    Alignment length:488
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481        
          PSBB_THEEB      2 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE  489
               SCOP domains d2axtb1 B:2-489 Photosystem II core light harvesting protein PsbB                                                                                                                                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhh..hhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.........hhhhhhhhhhhhhhhhhhhhhhhh........eee........eee......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhh..hhhhhhhhhhhhh..........hhhhh..eeeee..eeeee.....eeee............eee.....eeee...hhhhh.........eeeee.......ee.hhhhhhhhhhhhh....eeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt B    2 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE  489
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481

Chain C from PDB  Type:PROTEIN  Length:447
 aligned with PSBC_THEEB | Q8DIF8 from UniProtKB/Swiss-Prot  Length:461

    Alignment length:447
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       
          PSBC_THEEB     15 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD  461
               SCOP domains d2axtc1 C:27-473 Photosystem II CP43 protein PsbC                                                                                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2axtC02 C:304-399 photosystem ii from thermosynechococcus elongatus                             -------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhh..hhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhh.................eee.....eee.hhhhhhh......hhhhh.....hhhhhhhh.hhhhhhhhhhhhh....ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt C   27 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD  473
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466

Chain D from PDB  Type:PROTEIN  Length:340
 aligned with PSBD_THEEB | Q8CM25 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:340
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352
          PSBD_THEEB     13 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  352
               SCOP domains d2axtd1 D:13-352 Photosystem II reaction center d2 protein PsbD2                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhh...........................hhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh.hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt D   13 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  352
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352

Chain E from PDB  Type:PROTEIN  Length:82
 aligned with PSBE_THEEB | Q8DIP0 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
          PSBE_THEEB      3 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
               SCOP domains d2axte1 E:3-84 Cytochrome b559 subunit alpha, PsbE                                 SCOP domains
               CATH domains 2axtE00 E:3-84 Photosystem q(b) protein helix                                      CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------CYTOCHROME_B559-------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                2axt E    3 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
                                    12        22        32        42        52        62        72        82

Chain F from PDB  Type:PROTEIN  Length:35
 aligned with PSBF_THEEB | Q8DIN9 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:35
                                    20        30        40     
          PSBF_THEEB     11 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
               SCOP domains d2axtf1 F:11-45                     SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                PROSITE (2) ----CYTOCHROME_B559---------------- PROSITE (2)
                 Transcript ----------------------------------- Transcript
                2axt F   11 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
                                    20        30        40

Chain H from PDB  Type:PROTEIN  Length:64
 aligned with PSBH_THEEB | Q8DJ43 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:64
                                    11        21        31        41        51        61    
          PSBH_THEEB      2 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL   65
               SCOP domains d2axth1 H:2-65 Photosystem II reaction center protein H, PsbH    SCOP domains
               CATH domains 2axtH01 H:2-52                                     ------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                2axt H    2 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL   65
                                    11        21        31        41        51        61

Chain I from PDB  Type:PROTEIN  Length:35
 aligned with PSBI_THEEB | Q8DJZ6 from UniProtKB/Swiss-Prot  Length:38

    Alignment length:35
                                    10        20        30     
          PSBI_THEEB      1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK   35
               SCOP domains d2axti1 I:1-35                      SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                2axt I    1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK   35
                                    10        20        30

Chain J from PDB  Type:PROTEIN  Length:34
 aligned with PSBJ_THEEB | P59087 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    16        26        36    
          PSBJ_THEEB      7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
               SCOP domains d2axtj1 J:7-40                     SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                2axt J    7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
                                    16        26        36

Chain K from PDB  Type:PROTEIN  Length:37
 aligned with PSBK_THEEB | Q9F1K9 from UniProtKB/Swiss-Prot  Length:46

    Alignment length:37
                                    19        29        39       
          PSBK_THEEB     10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR   46
               SCOP domains d2axtk1 K:10-46                       SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                2axt K   10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR   46
                                    19        29        39

Chain L from PDB  Type:PROTEIN  Length:37
 aligned with PSBL_THEEB | Q8DIN8 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
          PSBL_THEEB      1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
               SCOP domains d2axtl1 L:1-37                        SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                2axt L    1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
                                    10        20        30

Chain M from PDB  Type:PROTEIN  Length:36
 aligned with PSBM_THEEB | Q8DHA7 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:36
                                    10        20        30      
          PSBM_THEEB      1 MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS   36
               SCOP domains d2axtm1 M:1-36                       SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                2axt M    1 MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS   36
                                    10        20        30

Chain O from PDB  Type:PROTEIN  Length:242
 aligned with PSBO_THEEB | P0A431 from UniProtKB/Swiss-Prot  Length:272

    Alignment length:242
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269  
          PSBO_THEEB     30 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP  271
               SCOP domains d2axto1 O:30-271 Manganese-stabilising protein, PsbO                                                                                                                                                                                               SCOP domains
               CATH domains --------------------2axtO01 O:50-178,O:215-271 Photosystem II, cytochrome c-550 precursor                                                            2axtO02 O:179-214                   2axtO01 O:50-178,O:215-271                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..........................eeeeeeeeeeeeeeee...........eeeeee.......eeeeeeeeee.....eeee..eee.eeeeeeee....eeeeeee.eeeeeee...........eeeeeeee..............................hhhhhhhhh.....eeeeeeeeeee......eeeeeeeeeee...........eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt O   30 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP  271
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269

Chain T from PDB  Type:PROTEIN  Length:30
 aligned with PSBT_THEEB | Q8DIQ0 from UniProtKB/Swiss-Prot  Length:32

    Alignment length:30
                                    10        20        30
          PSBT_THEEB      1 METITYVFIFACIIALFFFAIFFREPPRIT   30
               SCOP domains d2axtt1 T:1-30                 SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                2axt T    1 METITYVFIFACIIALFFFAIFFREPPRIT   30
                                    10        20        30

Chain U from PDB  Type:PROTEIN  Length:98
 aligned with PSBU_THEEB | Q9F1L5 from UniProtKB/Swiss-Prot  Length:134

    Alignment length:98
                                    46        56        66        76        86        96       106       116       126        
          PSBU_THEEB     37 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  134
               SCOP domains d2axtu1 U:37-134 Photosystem II 12 kDa extrinsic protein PsbU                                      SCOP domains
               CATH domains 2axtU01 U:37-123 Photosystem II 12 kDa extrinsic protein                               ----------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh.......ee....hhhhhh.....hhhhhhhhhhh....hhhhhhhh.....hhhhhhhhhh..ee....hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                2axt U   37 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  134
                                    46        56        66        76        86        96       106       116       126

Chain V from PDB  Type:PROTEIN  Length:137
 aligned with CY550_THEEB | P0A386 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
         CY550_THEEB     27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
               SCOP domains d2axtv_ V: automated matches                                                                                                              SCOP domains
               CATH domains 2axtV00 V:27-163 Cytochrome c                                                                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee......eee.hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhh......hhhhhhhhhhh...............hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: V:50-149 UniProt: 50-149                                                                 -------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt V   27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
                                    36        46        56        66        76        86        96       106       116       126       136       146       156

Chain X from PDB  Type:PROTEIN  Length:104
                                                                                                                                         
               SCOP domains -------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                2axt X    1 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx  129
                            ||||||||10||||||||20||||||||30||||||||58||||||||68||||||||78||||||||88|||||||105|||||||115|||||||125||||
                            1-UNK|||10-UNK|||19-UNK|||28-UNK|||55-UNK|||64-UNK|||73-UNK|||82-UNK|||91-UNK||107-UNK||116-UNK||125-UNK
                             2-UNK|||11-UNK|||20-UNK|||29-UNK|||56-UNK|||65-UNK|||74-UNK|||83-UNK|||92-UNK||108-UNK||117-UNK||126-UNK
                              3-UNK|| 12-UNK|| 21-UNK|| 30-UNK|| 57-UNK|| 66-UNK|| 75-UNK|| 84-UNK||100-UNK||109-UNK||118-UNK||127-UNK
                               4-UNK|  13-UNK|  22-UNK|  31-UNK|  58-UNK|  67-UNK|  76-UNK|  85-UNK| 101-UNK| 110-UNK| 119-UNK| 128-UNK
                                5-UNK   14-UNK   23-UNK   50-UNK   59-UNK   68-UNK   77-UNK   86-UNK  102-UNK  111-UNK  120-UNK  129-UNK
                                 6-UNK   15-UNK   24-UNK   51-UNK   60-UNK   69-UNK   78-UNK   87-UNK  103-UNK  112-UNK  121-UNK    
                                  7-UNK   16-UNK   25-UNK   52-UNK   61-UNK   70-UNK   79-UNK   88-UNK  104-UNK  113-UNK  122-UNK   
                                   8-UNK   17-UNK   26-UNK   53-UNK   62-UNK   71-UNK   80-UNK   89-UNK  105-UNK  114-UNK  123-UNK  
                                    9-UNK   18-UNK   27-UNK   54-UNK   63-UNK   72-UNK   81-UNK   90-UNK  106-UNK  115-UNK  124-UNK

Chain Z from PDB  Type:PROTEIN  Length:62
 aligned with PSBZ_THEEB | Q8DHJ2 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:62
                                    10        20        30        40        50        60  
          PSBZ_THEEB      1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV   62
               SCOP domains d2axtz1 Z:1-62 Photosystem II reaction center protein Z, PsbZ  SCOP domains
               CATH domains 2axtZ00 Z:1-62 Helix hairpin bin                               CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                2axt Z    1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV   62
                                    10        20        30        40        50        60

Chain a from PDB  Type:PROTEIN  Length:335
 aligned with PSBA1_THEEB | P0A444 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:335
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     
         PSBA1_THEEB     10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA  344
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh...............hhhhh......ee............hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhh.......eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhh.........hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt a 5010 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA 5344
                                  5019      5029      5039      5049      5059      5069      5079      5089      5099      5109      5119      5129      5139      5149      5159      5169      5179      5189      5199      5209      5219      5229      5239      5249      5259      5269      5279      5289      5299      5309      5319      5329      5339

Chain b from PDB  Type:PROTEIN  Length:488
 aligned with PSBB_THEEB | Q8DIQ1 from UniProtKB/Swiss-Prot  Length:510

    Alignment length:488
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481        
          PSBB_THEEB      2 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE  489
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhh..hhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.........hhhhhhhhhhhhhhhhhhhhhhhh........eee........eee......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhh..hhhhhhhhhhhhh..........hhhhhh.eeeee..eeeee.....eeee............eee.....eeee...hhhhh.........eeeee.......ee.hhhhhhhhhhhhh....eeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt b 5002 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPE 5489
                                  5011      5021      5031      5041      5051      5061      5071      5081      5091      5101      5111      5121      5131      5141      5151      5161      5171      5181      5191      5201      5211      5221      5231      5241      5251      5261      5271      5281      5291      5301      5311      5321      5331      5341      5351      5361      5371      5381      5391      5401      5411      5421      5431      5441      5451      5461      5471      5481

Chain c from PDB  Type:PROTEIN  Length:447
 aligned with PSBC_THEEB | Q8DIF8 from UniProtKB/Swiss-Prot  Length:461

    Alignment length:447
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       
          PSBC_THEEB     15 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD  461
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2axtc02 c:5304-5399 photosystem ii from thermosynechococcus elongatus                           -------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhh..hhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhh.................eee.....eee.hhhhhhh......hhhhh.....hhhhhhhh.hhhhhhhhhhhhh....ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt c 5027 DQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD 5473
                                  5036      5046      5056      5066      5076      5086      5096      5106      5116      5126      5136      5146      5156      5166      5176      5186      5196      5206      5216      5226      5236      5246      5256      5266      5276      5286      5296      5306      5316      5326      5336      5346      5356      5366      5376      5386      5396      5406      5416      5426      5436      5446      5456      5466

Chain d from PDB  Type:PROTEIN  Length:340
 aligned with PSBD_THEEB | Q8CM25 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:340
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352
          PSBD_THEEB     13 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL  352
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhh...........................hhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhh.hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt d 5013 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 5352
                                  5022      5032      5042      5052      5062      5072      5082      5092      5102      5112      5122      5132      5142      5152      5162      5172      5182      5192      5202      5212      5222      5232      5242      5252      5262      5272      5282      5292      5302      5312      5322      5332      5342      5352

Chain e from PDB  Type:PROTEIN  Length:82
 aligned with PSBE_THEEB | Q8DIP0 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:82
                                    12        22        32        42        52        62        72        82  
          PSBE_THEEB      3 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK   84
               SCOP domains ---------------------------------------------------------------------------------- SCOP domains
               CATH domains 2axte00 e:5003-5084 Photosystem q(b) protein helix                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------CYTOCHROME_B559-------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------- Transcript
                2axt e 5003 GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK 5084
                                  5012      5022      5032      5042      5052      5062      5072      5082

Chain f from PDB  Type:PROTEIN  Length:35
 aligned with PSBF_THEEB | Q8DIN9 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:35
                                    20        30        40     
          PSBF_THEEB     11 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR   45
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                PROSITE (2) ----CYTOCHROME_B559---------------- PROSITE (2)
                 Transcript ----------------------------------- Transcript
                2axt f 5011 VSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR 5045
                                  5020      5030      5040

Chain h from PDB  Type:PROTEIN  Length:64
 aligned with PSBH_THEEB | Q8DJ43 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:64
                                    11        21        31        41        51        61    
          PSBH_THEEB      2 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL   65
               SCOP domains ---------------------------------------------------------------- SCOP domains
               CATH domains 2axth01 h:5002-5052                                ------------- CATH domains
               Pfam domains ---------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------- Transcript
                2axt h 5002 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL 5065
                                  5011      5021      5031      5041      5051      5061

Chain i from PDB  Type:PROTEIN  Length:35
 aligned with PSBI_THEEB | Q8DJZ6 from UniProtKB/Swiss-Prot  Length:38

    Alignment length:35
                                    10        20        30     
          PSBI_THEEB      1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK   35
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                2axt i 5001 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK 5035
                                  5010      5020      5030

Chain j from PDB  Type:PROTEIN  Length:34
 aligned with PSBJ_THEEB | P59087 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    16        26        36    
          PSBJ_THEEB      7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL   40
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains ---------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                2axt j 5007 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL 5040
                                  5016      5026      5036

Chain k from PDB  Type:PROTEIN  Length:37
 aligned with PSBK_THEEB | Q9F1K9 from UniProtKB/Swiss-Prot  Length:46

    Alignment length:37
                                    19        29        39       
          PSBK_THEEB     10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR   46
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                2axt k 5010 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR 5046
                                  5019      5029      5039

Chain l from PDB  Type:PROTEIN  Length:37
 aligned with PSBL_THEEB | Q8DIN8 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
          PSBL_THEEB      1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN   37
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                2axt l 5001 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN 5037
                                  5010      5020      5030

Chain m from PDB  Type:PROTEIN  Length:36
 aligned with PSBM_THEEB | Q8DHA7 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:36
                                    10        20        30      
          PSBM_THEEB      1 MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS   36
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                2axt m 5001 MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS 5036
                                  5010      5020      5030

Chain o from PDB  Type:PROTEIN  Length:242
 aligned with PSBO_THEEB | P0A431 from UniProtKB/Swiss-Prot  Length:272

    Alignment length:242
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269  
          PSBO_THEEB     30 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP  271
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------2axto01 o:5050-5178,o:5215-5271 Photosystem II, cytochrome c-550 precursor                                                       2axto02 o:5179-5214                 2axto01 o:5050-5178,o:5215-5271                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..........................eeeeeeeeeeeeeeee...........eeeeee.......eeeeeeeeee.....eeee..eee.eeeeeeee....eeeeeee.eeeeee............eeeeeeee..............................hhhhhhhhh.....eeeeeeeeeee......eeeeeeeeeee...........eeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt o 5030 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEP 5271
                                  5039      5049      5059      5069      5079      5089      5099      5109      5119      5129      5139      5149      5159      5169      5179      5189      5199      5209      5219      5229      5239      5249      5259      5269

Chain t from PDB  Type:PROTEIN  Length:30
 aligned with PSBT_THEEB | Q8DIQ0 from UniProtKB/Swiss-Prot  Length:32

    Alignment length:30
                                    10        20        30
          PSBT_THEEB      1 METITYVFIFACIIALFFFAIFFREPPRIT   30
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                2axt t 5001 METITYVFIFACIIALFFFAIFFREPPRIT 5030
                                  5010      5020      5030

Chain u from PDB  Type:PROTEIN  Length:98
 aligned with PSBU_THEEB | Q9F1L5 from UniProtKB/Swiss-Prot  Length:134

    Alignment length:98
                                    46        56        66        76        86        96       106       116       126        
          PSBU_THEEB     37 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK  134
               SCOP domains -------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2axtu01 u:5037-5123 Photosystem II 12 kDa extrinsic protein                            ----------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhh.......ee....hhhhhh.....hhhhhhhhhhh....hhhhhhhh.....hhhhhhhhhh..ee....hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                2axt u 5037 EELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK 5134
                                  5046      5056      5066      5076      5086      5096      5106      5116      5126

Chain v from PDB  Type:PROTEIN  Length:137
 aligned with CY550_THEEB | P0A386 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
         CY550_THEEB     27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY  163
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2axtv00 v:5027-5163 Cytochrome c                                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee......eee.hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhh......hhhhhhhhhhh...............hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: v:5050-5149 UniProt: 50-149                                                              -------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2axt v 5027 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY 5163
                                  5036      5046      5056      5066      5076      5086      5096      5106      5116      5126      5136      5146      5156

Chain x from PDB  Type:PROTEIN  Length:104
                                                                                                                                         
               SCOP domains -------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.hhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                2axt x 5001 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 5129
                            ||||||5010||||||5020||||||5030||||||5058||||||5068||||||5078||||||5088||||||5105||||||5115||||||5125||||
                            |||||5009-UNK|5018-UNK|5027-UNK|5054-UNK|5063-UNK|5072-UNK|5081-UNK|5090-UNK|5106-UNK|5115-UNK|5124-UNK|
                         5001-UNK|5010-UNK|5019-UNK|5028-UNK|5055-UNK|5064-UNK|5073-UNK|5082-UNK|5091-UNK|5107-UNK|5116-UNK|5125-UNK
                          5002-UNK|5011-UNK|5020-UNK|5029-UNK|5056-UNK|5065-UNK|5074-UNK|5083-UNK|5092-UNK|5108-UNK|5117-UNK|5126-UNK
                           5003-UNK|5012-UNK|5021-UNK|5030-UNK|5057-UNK|5066-UNK|5075-UNK|5084-UNK|5100-UNK|5109-UNK|5118-UNK|5127-UNK
                            5004-UNK 5013-UNK 5022-UNK 5031-UNK 5058-UNK 5067-UNK 5076-UNK 5085-UNK 5101-UNK 5110-UNK 5119-UNK 5128-UNK
                             5005-UNK 5014-UNK 5023-UNK 5050-UNK 5059-UNK 5068-UNK 5077-UNK 5086-UNK 5102-UNK 5111-UNK 5120-UNK 5129-UNK
                              5006-UNK 5015-UNK 5024-UNK 5051-UNK 5060-UNK 5069-UNK 5078-UNK 5087-UNK 5103-UNK 5112-UNK 5121-UNK    
                               5007-UNK 5016-UNK 5025-UNK 5052-UNK 5061-UNK 5070-UNK 5079-UNK 5088-UNK 5104-UNK 5113-UNK 5122-UNK   
                                5008-UNK 5017-UNK 5026-UNK 5053-UNK 5062-UNK 5071-UNK 5080-UNK 5089-UNK 5105-UNK 5114-UNK 5123-UNK

Chain z from PDB  Type:PROTEIN  Length:62
 aligned with PSBZ_THEEB | Q8DHJ2 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:62
                                    10        20        30        40        50        60  
          PSBZ_THEEB      1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV   62
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains 2axtz00 z:5001-5062 Helix hairpin bin                          CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                2axt z 5001 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV 5062
                                  5010      5020      5030      5040      5050      5060

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (17, 17)

CATH Domains (8, 16)

Pfam Domains (0, 0)

Gene Ontology (30, 197)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PSBA1_SYNEL | P0A445)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0010242	oxygen evolving activity	Catalysis of the reaction: 2 H2O = O2 + 4 H+ + 4 e-. The evolution of oxygen from oxidizing water is carried out by the oxygen evolving complex in photosystem II of plants. P680+, the photochemically oxidized reaction-center chlorophyll of PSII, is a strong biological oxidant. The reduction potential of P680+ is more positive than that of water, and thus it can oxidize water to give O2 and H+ ions. The oxygen escapes as a gas while the H+ ions remain in solution inside the thylakoid vesicle.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
	GO:0009635	response to herbicide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain A,a (PSBA1_THEEB | P0A444)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0010242	oxygen evolving activity	Catalysis of the reaction: 2 H2O = O2 + 4 H+ + 4 e-. The evolution of oxygen from oxidizing water is carried out by the oxygen evolving complex in photosystem II of plants. P680+, the photochemically oxidized reaction-center chlorophyll of PSII, is a strong biological oxidant. The reduction potential of P680+ is more positive than that of water, and thus it can oxidize water to give O2 and H+ ions. The oxygen escapes as a gas while the H+ ions remain in solution inside the thylakoid vesicle.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
	GO:0009635	response to herbicide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain B,b (PSBB_THEEB | Q8DIQ1)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009521	photosystem	A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain C,c (PSBC_THEEB | Q8DIF8)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009521	photosystem	A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain D,d (PSBD_THEEB | Q8CM25)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain E,e (PSBE_THEEB | Q8DIP0)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain F,f (PSBF_THEEB | Q8DIN9)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain H,h (PSBH_THEEB | Q8DJ43)

molecular function
	GO:0042301	phosphate ion binding	Interacting selectively and non-covalently with phosphate.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0050821	protein stabilization	Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain I,i (PSBI_THEEB | Q8DJZ6)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain J,j (PSBJ_THEEB | P59087)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain K,k (PSBK_THEEB | Q9F1K9)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain L,l (PSBL_THEEB | Q8DIN8)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain M,m (PSBM_THEEB | Q8DHA7)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain O,o (PSBO_THEEB | P0A431)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009654	photosystem II oxygen evolving complex	A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain T,t (PSBT_THEEB | Q8DIQ0)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain U,u (PSBU_THEEB | Q9F1L5)

biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009654	photosystem II oxygen evolving complex	A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain V,v (CY550_THEEB | P0A386)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0018063	cytochrome c-heme linkage	The linkage of cytochromes and other heme proteins to heme.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0022904	respiratory electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain Z,z (PSBZ_THEEB | Q8DHJ2)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (15, 388)

Sites (146, 146)

SS Bonds (2, 2)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 10)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (17, 17)

CATH Domains (8, 16)

Pfam Domains (0, 0)

Gene Ontology (30, 197)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File