5H2F - JenaLib

Asymmetric Unit (321, 321)

No.	Name	Evidence	Residues	Description
001	AC1	SOFTWARE	ASP A:170 , GLU A:189 , HIS A:332 , GLU A:333 , HIS A:337 , ASP A:342 , ALA A:344 , HOH A:515 , HOH A:519 , HOH A:521 , HOH A:522 , HOH A:591 , HOH A:604 , GLU C:354 , ARG C:357	binding site for residue OEX A 401
002	AC2	SOFTWARE	HIS A:215 , HIS A:272 , BCT A:421 , HIS D:214 , HIS D:268	binding site for residue FE2 A 402
003	AC3	SOFTWARE	ASN A:181 , GLU A:333 , LYS D:317	binding site for residue CL A 403
004	AC4	SOFTWARE	ASN A:338 , HOH A:592 , GLU C:354 , HOH C:676	binding site for residue CL A 404
005	AC5	SOFTWARE	TYR A:147 , PRO A:150 , SER A:153 , VAL A:157 , MET A:183 , PHE A:186 , GLN A:187 , ILE A:192 , HIS A:198 , GLY A:201 , PHE A:206 , THR A:286 , ALA A:287 , ILE A:290 , CLA A:406 , PHO A:407 , HOH A:597 , LEU D:205 , CLA D:401 , CLA D:403	binding site for residue CLA A 405
006	AC6	SOFTWARE	GLN A:199 , VAL A:202 , ALA A:203 , PHE A:206 , GLY A:207 , LEU A:210 , TRP A:278 , CLA A:405 , HOH A:546 , HOH A:614 , VAL D:175 , ILE D:178 , PHE D:179 , LEU D:182 , PHO D:402 , CLA D:403 , HOH D:596	binding site for residue CLA A 406
007	AC7	SOFTWARE	LEU A:41 , ALA A:44 , THR A:45 , PHE A:48 , ILE A:115 , TYR A:126 , GLN A:130 , ALA A:146 , TYR A:147 , PRO A:150 , GLY A:175 , PRO A:279 , VAL A:283 , CLA A:405 , ALA D:208 , LEU D:209 , ILE D:213 , TRP D:253 , CLA D:401 , LHG D:410	binding site for residue PHO A 407
008	AC8	SOFTWARE	THR A:40 , PHE A:93 , PRO A:95 , ILE A:96 , TRP A:97 , LEU A:114 , PHE A:117 , HIS A:118 , LEU A:121 , BCR A:409 , LMG A:410 , CLA C:507 , VAL I:8 , VAL I:11 , VAL I:12 , THR I:13 , PHE I:15	binding site for residue CLA A 408
009	AC9	SOFTWARE	PHE A:17 , LEU A:42 , ALA A:43 , ILE A:50 , ILE A:96 , CLA A:408	binding site for residue BCR A 409
010	AD1	SOFTWARE	PHE A:93 , TRP A:97 , GLU A:98 , LEU A:121 , CLA A:408 , HOH A:538 , HOH A:548 , LEU C:214 , LYS C:215 , PHE C:218 , GLU C:221 , TRP C:223 , PHE C:284 , CLA C:506 , LYS I:5 , TYR I:9	binding site for residue LMG A 410
011	AD2	SOFTWARE	PHE A:211 , MET A:214 , HIS A:215 , LEU A:218 , PHE A:255 , ILE A:259 , ALA A:263 , SER A:264 , PHE A:265 , LEU A:271 , PHE A:274 , PRO D:39 , LEU D:45 , PHO D:402 , ALA F:22 , THR X:24	binding site for residue PL9 A 411
012	AD3	SOFTWARE	ARG A:16 , PHE A:17 , ASN A:19 , TRP A:20	binding site for residue LHG A 412
013	AD4	SOFTWARE	TRP A:20 , ASN A:26 , ARG A:27 , LEU A:28 , VAL A:30 , LEU A:42 , PHE T:22 , TRP b:113 , TYR b:117 , ARG h:3	binding site for residue SQD A 413
014	AD5	SOFTWARE	LEU A:72 , TYR A:73 , DMS A:418 , HOH A:502 , HOH A:541 , ARG D:304 , HOH T:202 , ALA b:43 , DMS b:633	binding site for residue LMT A 414
015	AD6	SOFTWARE	ASN A:315 , HIS D:61 , ILE E:63	binding site for residue DMS A 416
016	AD7	SOFTWARE	GLU A:98 , DMS I:101	binding site for residue DMS A 417
017	AD8	SOFTWARE	PRO A:66 , LMT A:414 , HOH A:568 , GLU D:310 , ARG O:115	binding site for residue DMS A 418
018	AD9	SOFTWARE	LEU A:102 , ASP A:103 , HOH A:554 , TRP b:75 , HTG b:623	binding site for residue DMS A 419
019	AE1	SOFTWARE	ARG A:64 , GLU A:65 , PRO A:66 , HOH A:559 , HOH A:588 , PRO D:309 , GLU D:310 , ARG O:152	binding site for residue DMS A 420
020	AE2	SOFTWARE	HIS A:215 , VAL A:219 , GLU A:244 , TYR A:246 , HIS A:272 , FE2 A:402 , HOH A:501 , HOH A:535 , HIS D:214 , TYR D:244 , HIS D:268	binding site for residue BCT A 421
021	AE3	SOFTWARE	ASN B:438 , HOH B:720 , HOH B:850 , HOH B:932 , HOH O:518	binding site for residue CA B 601
022	AE4	SOFTWARE	GLY B:186 , PHE B:190 , CLA B:603 , HOH B:705 , PHE H:41 , RRX H:101	binding site for residue CLA B 602
023	AE5	SOFTWARE	GLY B:189 , PHE B:190 , GLY B:197 , ALA B:200 , HIS B:201 , ALA B:204 , ALA B:205 , VAL B:208 , PHE B:250 , CLA B:602 , CLA B:604 , CLA B:606 , HOH B:844 , PHE H:38 , PHE H:41 , LEU H:46 , TYR H:49	binding site for residue CLA B 603
024	AE6	SOFTWARE	ARG B:68 , LEU B:69 , ALA B:146 , LEU B:149 , CYS B:150 , PHE B:153 , HIS B:201 , HIS B:202 , PHE B:247 , ALA B:248 , VAL B:252 , THR B:262 , CLA B:603 , CLA B:605 , CLA B:606 , CLA B:607 , HOH B:731 , PHE H:38	binding site for residue CLA B 604
025	AE7	SOFTWARE	TRP B:33 , PHE B:65 , ARG B:68 , LEU B:149 , VAL B:245 , ALA B:248 , ALA B:249 , VAL B:252 , PHE B:451 , HIS B:455 , PHE B:458 , PHE B:462 , CLA B:604 , CLA B:606 , CLA B:608 , CLA B:612 , CLA B:613 , CLA B:614 , CLA B:616	binding site for residue CLA B 605
026	AE8	SOFTWARE	THR B:27 , VAL B:30 , ALA B:31 , TRP B:33 , ALA B:34 , VAL B:62 , PHE B:65 , MET B:66 , ARG B:68 , HIS B:100 , CYS B:150 , ALA B:205 , CLA B:603 , CLA B:604 , CLA B:605 , CLA B:607 , CLA B:611 , CLA B:613 , CLA B:616 , BCR B:620 , HOH B:734	binding site for residue CLA B 606
027	AE9	SOFTWARE	GLY B:70 , PHE B:90 , TRP B:91 , VAL B:96 , GLY B:152 , PHE B:153 , HIS B:157 , PHE B:162 , PRO B:164 , CLA B:604 , CLA B:606 , HTG B:627	binding site for residue CLA B 607
028	AF1	SOFTWARE	TRP B:33 , TYR B:40 , GLN B:58 , GLY B:59 , MET B:60 , PHE B:61 , LEU B:324 , THR B:327 , GLY B:328 , PRO B:329 , TRP B:450 , PHE B:451 , ALA B:454 , CLA B:605 , LMG B:621 , HOH B:855 , PHE D:196 , MET D:199 , MET D:281 , PL9 D:406 , LHG D:409 , PHE L:31	binding site for residue CLA B 608
029	AF2	SOFTWARE	LEU B:229 , THR B:236 , SER B:239 , SER B:240 , ALA B:243 , PHE B:463 , HIS B:466 , ILE B:467 , THR B:473 , CLA B:610 , CLA B:611 , HOH B:724 , ILE D:123 , MET D:126 , LMG D:412	binding site for residue CLA B 609
030	AF3	SOFTWARE	PHE B:139 , VAL B:208 , ALA B:212 , PHE B:215 , HIS B:216 , VAL B:219 , PRO B:221 , PRO B:222 , LEU B:229 , CLA B:609 , CLA B:611 , THR H:27 , MET H:31 , PHE H:34 , RRX H:101	binding site for residue CLA B 610
031	AF4	SOFTWARE	HIS B:23 , LEU B:135 , PHE B:139 , HIS B:142 , LEU B:143 , MET B:231 , THR B:236 , VAL B:237 , SER B:240 , SER B:241 , CLA B:606 , CLA B:609 , CLA B:610 , CLA B:613 , CLA B:616 , HOH B:710	binding site for residue CLA B 611
032	AF5	SOFTWARE	TRP B:5 , TYR B:6 , ARG B:7 , VAL B:8 , HIS B:9 , THR B:10 , ILE B:242 , LEU B:461 , PHE B:462 , GLY B:465 , TRP B:468 , HIS B:469 , ARG B:472 , CLA B:605 , CLA B:613 , CLA B:614 , CLA B:615 , LHG D:409 , HOH D:515	binding site for residue CLA B 612
033	AF6	SOFTWARE	HIS B:9 , LEU B:19 , HIS B:23 , HIS B:26 , THR B:27 , ILE B:234 , VAL B:237 , LEU B:238 , SER B:241 , VAL B:245 , CLA B:605 , CLA B:606 , CLA B:611 , CLA B:612 , CLA B:614 , CLA B:615 , CLA B:616	binding site for residue CLA B 613
034	AF7	SOFTWARE	HIS B:9 , HIS B:26 , VAL B:30 , TRP B:33 , PHE B:462 , CLA B:605 , CLA B:612 , CLA B:613 , CLA B:615 , LMG B:621 , LHG D:409	binding site for residue CLA B 614
035	AF8	SOFTWARE	VAL B:8 , HIS B:9 , VAL B:11 , LEU B:29 , TRP B:115 , CLA B:612 , CLA B:613 , CLA B:614 , BCR B:618 , HOH B:839 , GLN L:8 , VAL L:10 , SQD l:101	binding site for residue CLA B 615
036	AF9	SOFTWARE	ILE B:20 , HIS B:23 , LEU B:24 , LEU B:133 , MET B:138 , HIS B:142 , LEU B:145 , CLA B:605 , CLA B:606 , CLA B:611 , CLA B:613 , CLA B:617 , LEU H:14	binding site for residue CLA B 616
037	AG1	SOFTWARE	LEU B:24 , TRP B:113 , HIS B:114 , CLA B:616 , BCR B:620 , HOH B:832 , THR H:5 , LEU H:7 , GLY H:8	binding site for residue CLA B 617
038	AG2	SOFTWARE	MET B:25 , LEU B:29 , TRP B:115 , CLA B:615 , SQD l:101 , PHE t:19	binding site for residue BCR B 618
039	AG3	SOFTWARE	LEU B:29 , GLY B:32 , TRP B:33 , SER B:36 , GLY B:105	binding site for residue BCR B 619
040	AG4	SOFTWARE	LEU B:109 , ALA B:110 , CLA B:606 , CLA B:617 , SQD a:418 , PHE t:18 , PHE t:22	binding site for residue BCR B 620
041	AG5	SOFTWARE	TYR B:40 , THR B:327 , LYS B:332 , ALA B:454 , CLA B:608 , CLA B:614 , HOH B:725 , HOH B:833 , PHE L:35	binding site for residue LMG B 621
042	AG6	SOFTWARE	ARG B:224 , LEU B:225 , ALA B:228 , PHE D:15 , ASP D:16 , ASP D:19 , LMG D:412 , TRP H:25 , ALA H:32	binding site for residue LMT B 622
043	AG7	SOFTWARE	SER B:76 , TRP B:78 , GLU B:94 , LEU B:98 , DMS B:635 , HOH B:763 , LMT a:419 , GLY o:112 , GLY o:113	binding site for residue HTG B 623
044	AG8	SOFTWARE	TRP B:75 , ASP B:87 , GLY B:89 , PHE B:90 , HTG B:627 , DMS B:635 , HOH B:702 , HOH B:790 , LEU a:102 , BCR a:413	binding site for residue HTG B 626
045	AG9	SOFTWARE	ASP B:87 , PHE B:90 , CLA B:607 , HTG B:626	binding site for residue HTG B 627
046	AH1	SOFTWARE	TRP B:275 , ASP B:276 , SER B:278 , ARG B:358 , MET B:359 , PRO B:360 , DMS B:641 , HOH B:711 , HOH D:502	binding site for residue DMS B 628
047	AH2	SOFTWARE	ALA B:386 , SER B:388 , TYR U:21 , GLY U:22	binding site for residue DMS B 629
048	AH3	SOFTWARE	ILE B:13 , PRO B:131 , ALA B:132 , LEU B:133	binding site for residue DMS B 630
049	AH4	SOFTWARE	ASN B:348 , LYS B:349 , GLU B:350 , GLN B:395	binding site for residue DMS B 631
050	AH5	SOFTWARE	GLN B:409 , THR B:410 , PHE B:411 , DMS B:636 , HOH B:717	binding site for residue DMS B 632
051	AH6	SOFTWARE	TRP B:468 , ALA B:471 , PHE B:479 , PRO D:140 , TYR D:141 , ILE D:144	binding site for residue DMS B 633
052	AH7	SOFTWARE	HOH B:877 , DMS t:103	binding site for residue DMS B 634
053	AH8	SOFTWARE	TRP B:75 , SER B:76 , HTG B:623 , HTG B:626 , ASP a:103	binding site for residue DMS B 635
054	AH9	SOFTWARE	THR B:410 , PHE B:411 , THR B:412 , ASP B:413 , DMS B:632	binding site for residue DMS B 636
055	AI1	SOFTWARE	THR B:412 , PRO B:414	binding site for residue DMS B 637
056	AI2	SOFTWARE	TYR B:390 , HOH B:778 , DMS D:416	binding site for residue DMS B 638
057	AI3	SOFTWARE	VAL B:116 , TRP B:118 , ASP B:119 , ARG H:3	binding site for residue DMS B 640
058	AI4	SOFTWARE	ASP B:276 , DMS B:628 , HOH B:711 , HOH B:829 , ASN D:83 , SER D:165 , GLU D:337 , HOH D:619	binding site for residue DMS B 641
059	AI5	SOFTWARE	SER B:303 , ALA B:304 , ILE B:305 , HOH B:853	binding site for residue DMS B 642
060	AI6	SOFTWARE	GLY A:204 , ASN A:267 , SER A:270 , PHE A:273 , TRP A:278 , GLN C:28 , ALA C:34 , TRP C:36 , CLA C:509 , LHG C:522 , PHE D:232 , ARG D:233 , LHG D:411 , ILE J:22 , BCR Y:101	binding site for residue SQD C 501
061	AI7	SOFTWARE	LEU C:95 , LEU C:168 , GLY C:171 , ALA C:172 , ILE C:224 , VAL C:233 , HIS C:237 , ALA C:278 , MET C:282 , PHE C:289 , VAL C:296 , TYR C:297 , CLA C:503 , CLA C:504 , CLA C:507 , CLA C:508 , BCR C:516 , HOH C:668	binding site for residue CLA C 502
062	AI8	SOFTWARE	TRP C:63 , HIS C:91 , LEU C:174 , LEU C:279 , MET C:282 , ALA C:286 , VAL C:290 , TYR C:297 , LEU C:426 , HIS C:430 , LEU C:433 , PHE C:437 , CLA C:502 , CLA C:504 , CLA C:505 , CLA C:511 , CLA C:513 , HTG C:521	binding site for residue CLA C 503
063	AI9	SOFTWARE	ILE C:60 , VAL C:61 , ALA C:64 , THR C:68 , LEU C:88 , HIS C:91 , VAL C:114 , HIS C:118 , CLA C:502 , CLA C:503 , CLA C:510 , CLA C:511 , CLA C:513 , LMG C:531	binding site for residue CLA C 504
064	AJ1	SOFTWARE	TRP C:63 , MET C:67 , PHE C:70 , GLN C:84 , GLY C:85 , ILE C:87 , TRP C:425 , SER C:429 , PHE C:436 , CLA C:503 , CLA C:511 , DGD C:518 , DGD C:519 , LMG C:520 , HOH C:658 , HOH C:722 , LHG D:411 , PRO K:26 , VAL K:30	binding site for residue CLA C 505
065	AJ2	SOFTWARE	MET A:127 , GLY A:128 , TRP A:131 , LMG A:410 , PHE C:264 , SER C:273 , TYR C:274 , GLY C:277 , HIS C:441 , LEU C:442 , ALA C:445 , ARG C:449 , CLA C:508 , BCR C:516 , HOH C:628	binding site for residue CLA C 506
066	AJ3	SOFTWARE	CLA A:408 , LEU C:165 , ILE C:243 , GLY C:247 , TRP C:250 , HIS C:251 , THR C:254 , THR C:255 , PRO C:256 , PHE C:257 , TRP C:259 , PHE C:264 , CLA C:502 , CLA C:508 , BCR C:516 , DGD C:517 , LMT I:102	binding site for residue CLA C 507
067	AJ4	SOFTWARE	MET C:157 , THR C:158 , LEU C:161 , HIS C:164 , LEU C:168 , CYS C:244 , PHE C:264 , TRP C:266 , TYR C:271 , TYR C:274 , SER C:275 , CLA C:502 , CLA C:506 , CLA C:507 , CLA C:510 , BCR C:516 , HOH C:607	binding site for residue CLA C 508
068	AJ5	SOFTWARE	TRP C:36 , ALA C:37 , GLY C:38 , ASN C:39 , ALA C:40 , GLU C:269 , LEU C:276 , PHE C:436 , PHE C:437 , GLY C:440 , TRP C:443 , HIS C:444 , ARG C:447 , SQD C:501 , CLA C:510 , CLA C:511 , CLA C:512 , LHG D:411	binding site for residue CLA C 509
069	AJ6	SOFTWARE	ASN C:39 , LEU C:42 , LEU C:49 , ALA C:52 , HIS C:53 , HIS C:56 , TYR C:149 , TRP C:151 , ILE C:160 , GLY C:268 , GLU C:269 , TYR C:271 , LEU C:272 , SER C:275 , LEU C:276 , LEU C:279 , CLA C:504 , CLA C:508 , CLA C:509 , CLA C:511 , CLA C:512 , CLA C:513	binding site for residue CLA C 510
070	AJ7	SOFTWARE	ASN C:39 , HIS C:56 , LEU C:59 , TRP C:63 , PHE C:436 , PHE C:437 , CLA C:503 , CLA C:504 , CLA C:505 , CLA C:509 , CLA C:510 , CLA C:512 , LHG D:411 , PRO K:29 , LEU K:33	binding site for residue CLA C 511
071	AJ8	SOFTWARE	ARG C:26 , TRP C:35 , GLY C:38 , ASN C:39 , ARG C:41 , LEU C:42 , LEU C:45 , LYS C:48 , ALA C:52 , ALA C:123 , GLY C:126 , PHE C:127 , ILE C:134 , CLA C:509 , CLA C:510 , CLA C:511 , PHE K:32 , LEU K:33 , TRP K:39 , GLN K:40 , BCR K:101 , ILE Y:36 , LEU Y:39 , ASN Y:45 , LEU Y:46 , VAL Z:20 , ALA Z:28	binding site for residue CLA C 512
072	AJ9	SOFTWARE	LEU C:50 , HIS C:53 , LEU C:125 , PHE C:146 , PHE C:147 , PHE C:163 , HIS C:164 , VAL C:167 , GLY C:171 , CLA C:503 , CLA C:504 , CLA C:510 , CLA C:514 , BCR C:515 , HOH C:697	binding site for residue CLA C 513
073	AK1	SOFTWARE	VAL C:54 , VAL C:124 , GLY C:128 , TYR C:131 , HIS C:132 , TYR C:143 , PHE C:147 , CLA C:513 , BCR C:515 , HTG C:532 , LMT Z:101	binding site for residue CLA C 514
074	AK2	SOFTWARE	PHE C:112 , VAL C:116 , ILE C:120 , SER C:121 , VAL C:124 , CLA C:513 , CLA C:514 , TYR K:15 , GLY Z:55 , ASN Z:58	binding site for residue BCR C 515
075	AK3	SOFTWARE	ILE C:209 , TYR C:212 , LEU C:213 , ASP C:232 , GLY C:236 , HIS C:237 , PHE C:264 , CLA C:502 , CLA C:506 , CLA C:507 , CLA C:508 , PHE I:23 , LEU I:24	binding site for residue BCR C 516
076	AK4	SOFTWARE	LEU A:91 , ILE A:163 , PRO C:217 , GLY C:219 , GLY C:220 , GLU C:221 , GLY C:222 , SER C:226 , VAL C:227 , PHE C:284 , CYS C:288 , PHE C:292 , ASN C:293 , ASN C:294 , THR C:295 , ASP C:360 , PHE C:361 , ARG C:362 , CLA C:507 , HOH C:605 , HOH C:643 , HOH C:647 , HOH C:649 , HOH C:657	binding site for residue DGD C 517
077	AK5	SOFTWARE	PHE A:197 , GLU C:83 , GLN C:84 , GLY C:85 , SER C:406 , ASN C:418 , PHE C:419 , VAL C:420 , TRP C:425 , CLA C:505 , DGD C:519 , LMG C:520 , HOH C:670 , TYR J:33 , HOH J:203	binding site for residue DGD C 518
078	AK6	SOFTWARE	GLN A:199 , PHE A:300 , ASN A:301 , PHE A:302 , SER A:305 , ASN C:405 , VAL C:407 , ASN C:415 , SER C:416 , ASN C:418 , CLA C:505 , DGD C:518 , HOH C:631 , HOH C:662 , LHG D:411 , PHE J:29 , ALA J:32 , TYR J:33 , GLY J:37 , SER J:38 , SER J:39 , LMG J:101 , HOH J:201 , HOH J:208 , GLN V:34	binding site for residue DGD C 519
079	AK7	SOFTWARE	HIS C:74 , GLN C:84 , CLA C:505 , DGD C:518 , HOH C:612 , VAL K:30	binding site for residue LMG C 520
080	AK8	SOFTWARE	TRP C:97 , PHE C:182 , CLA C:503 , LMG C:531	binding site for residue HTG C 521
081	AK9	SOFTWARE	TRP C:35 , SQD C:501 , HOH C:712 , ARG D:233 , PHE K:45	binding site for residue LHG C 522
082	AL1	SOFTWARE	ASP C:205 , TRP C:239 , LEU C:242 , DMS C:537	binding site for residue HTG C 523
083	AL2	SOFTWARE	TRP C:189 , ASN C:228 , ARG C:362 , HOH C:603	binding site for residue DMS C 524
084	AL3	SOFTWARE	GLY C:220 , ASP C:360 , ARG C:362 , TYR O:7 , HOH O:429	binding site for residue DMS C 525
085	AL4	SOFTWARE	GLU C:394 , PHE V:101	binding site for residue DMS C 526
086	AL5	SOFTWARE	PRO C:80 , GLU C:300 , DMS C:528	binding site for residue DMS C 527
087	AL6	SOFTWARE	GLY C:102 , GLU C:104 , DMS C:527 , ASP V:99 , PRO V:102 , ARG V:105	binding site for residue DMS C 528
088	AL7	SOFTWARE	GLY C:192 , GLY C:193	binding site for residue DMS C 529
089	AL8	SOFTWARE	TRP C:189 , PRO C:364 , GLU C:367 , PRO C:368 , HOH C:737	binding site for residue DMS C 530
090	AL9	SOFTWARE	TRP C:97 , ASP C:107 , PHE C:109 , VAL C:113 , VAL C:117 , HIS C:118 , CLA C:504 , HTG C:521 , PHE Z:59 , VAL Z:62	binding site for residue LMG C 531
091	AM1	SOFTWARE	TYR C:143 , CLA C:514	binding site for residue HTG C 532
092	AM2	SOFTWARE	VAL C:106	binding site for residue DMS C 533
093	AM3	SOFTWARE	GLU C:142	binding site for residue DMS C 534
094	AM4	SOFTWARE	PHE C:181	binding site for residue DMS C 535
095	AM5	SOFTWARE	VAL C:208 , GLY C:211 , TYR C:212 , LYS C:215	binding site for residue DMS C 536
096	AM6	SOFTWARE	LEU C:204 , ASP C:205 , HTG C:523	binding site for residue DMS C 537
097	AM7	SOFTWARE	THR C:254 , THR C:255 , PHE C:257	binding site for residue DMS C 538
098	AM8	SOFTWARE	LYS C:48 , ILE C:134 , GLY C:136 , GLU C:138	binding site for residue DMS C 539
099	AM9	SOFTWARE	LYS C:457 , HOH C:638 , HOH C:763 , ALA D:229	binding site for residue DMS C 540
100	AN1	SOFTWARE	MET A:172 , ILE A:176 , THR A:179 , PHE A:180 , MET A:183 , CLA A:405 , PHO A:407 , HOH A:578 , MET D:198 , VAL D:201 , ALA D:202 , GLY D:206 , PL9 D:406 , HOH D:521 , HOH D:598 , LHG L:101	binding site for residue CLA D 401
101	AN2	SOFTWARE	PHE A:206 , LEU A:210 , MET A:214 , LEU A:258 , ILE A:259 , CLA A:406 , PL9 A:411 , ALA D:41 , TRP D:48 , ILE D:114 , GLY D:121 , LEU D:122 , PHE D:125 , GLN D:129 , ASN D:142 , ALA D:145 , PHE D:146 , PRO D:149 , PHE D:153 , PHE D:173 , GLY D:174 , VAL D:175 , PRO D:275 , CLA D:403	binding site for residue PHO D 402
102	AN3	SOFTWARE	MET A:183 , CLA A:405 , CLA A:406 , PRO D:149 , VAL D:152 , SER D:155 , VAL D:156 , PHE D:181 , LEU D:182 , PHE D:185 , GLN D:186 , TRP D:191 , THR D:192 , HIS D:197 , GLY D:200 , LEU D:205 , SER D:282 , ALA D:283 , VAL D:286 , PHO D:402	binding site for residue CLA D 403
103	AN4	SOFTWARE	ILE D:35 , LEU D:43 , LEU D:89 , LEU D:90 , LEU D:91 , LEU D:92 , TRP D:93 , THR D:112 , PHE D:113 , LEU D:116 , HIS D:117 , HOH H:207 , GLY X:13 , LEU X:14 , LEU X:21	binding site for residue CLA D 404
104	AN5	SOFTWARE	TYR D:42 , GLY D:46 , GLY D:47 , LEU D:49 , THR D:50 , PHE D:101 , PRO F:29 , THR F:30 , PHE F:33 , VAL J:21	binding site for residue BCR D 405
105	AN6	SOFTWARE	CLA B:608 , MET D:198 , MET D:199 , ALA D:202 , HIS D:214 , THR D:217 , TRP D:253 , ALA D:260 , PHE D:261 , LEU D:267 , PHE D:273 , VAL D:274 , CLA D:401 , LHG D:410 , LHG L:101 , PHE T:10	binding site for residue PL9 D 406
106	AN7	SOFTWARE	PHE D:101 , THR D:102 , HOH D:594 , ASP E:45	binding site for residue DGD D 407
107	AN8	SOFTWARE	ARG D:24 , ARG D:26 , PHE F:16 , THR F:17 , VAL F:18 , ILE X:31 , ASP X:35	binding site for residue SQD D 408
108	AN9	SOFTWARE	ASN A:234 , TYR B:6 , ARG B:7 , TRP B:468 , PHE B:479 , CLA B:608 , CLA B:612 , CLA B:614 , TYR D:141 , TRP D:266 , PHE D:269 , THR D:277 , TRP D:280 , HOH D:515 , HOH D:535 , LEU L:27 , LHG L:101	binding site for residue LHG D 409
109	AO1	SOFTWARE	MET A:37 , ASN A:234 , PHO A:407 , PHE D:257 , ALA D:260 , PHE D:261 , SER D:262 , ASN D:263 , TRP D:266 , PHE D:270 , PL9 D:406 , ASN L:13 , THR L:15 , TYR L:18 , LHG L:101 , HOH L:201 , PHE T:17 , ALA T:20 , HOH T:203	binding site for residue LHG D 410
110	AO2	SOFTWARE	ARG A:140 , TRP A:142 , PHE A:273 , TRP C:36 , TRP C:443 , ARG C:447 , SQD C:501 , CLA C:505 , CLA C:509 , CLA C:511 , DGD C:519 , GLU D:219 , ASN D:220 , ALA D:229 , SER D:230 , THR D:231 , PHE D:232 , HOH D:505	binding site for residue LHG D 411
111	AO3	SOFTWARE	ALA B:228 , ARG B:230 , LYS B:498 , CLA B:609 , LMT B:622 , LYS D:23 , TRP D:32 , ARG D:134	binding site for residue LMG D 412
112	AO4	SOFTWARE	GLY D:13 , TRP D:14 , PHE D:15 , HOH D:537 , HOH D:567 , TRP H:25 , PRO H:29 , DMS H:103	binding site for residue HTG D 414
113	AO5	SOFTWARE	GLU B:387 , LYS B:389 , GLU D:343 , HOH D:511 , HOH D:516 , HOH D:548 , ALA U:34 , GLN U:37 , ARG V:55 , TYR V:136 , HOH V:301	binding site for residue HTG D 415
114	AO6	SOFTWARE	DMS B:638 , PHE D:341 , VAL V:135 , TYR V:136	binding site for residue DMS D 416
115	AO7	SOFTWARE	GLU D:307 , GLU O:181 , LEU O:182	binding site for residue DMS D 417
116	AO8	SOFTWARE	GLY A:74 , ARG D:304	binding site for residue DMS D 418
117	AO9	SOFTWARE	TRP E:35 , SER E:39 , ALA F:39	binding site for residue LMT E 101
118	AP1	SOFTWARE	ILE E:13 , ARG E:18 , TYR E:19 , HIS E:23 , THR E:26 , ILE F:15 , ARG F:19 , TRP F:20 , VAL F:23 , HIS F:24 , ALA F:27 , ILE F:31	binding site for residue HEM E 102
119	AP2	SOFTWARE	GLN F:44 , ARG F:45 , GLY J:35 , SER J:38 , LEU J:40 , HOH J:210	binding site for residue DMS F 101
120	AP3	SOFTWARE	CLA B:602 , CLA B:610 , PHE H:34 , LEU H:37 , PHE H:38 , ILE H:44 , THR X:2	binding site for residue RRX H 101
121	AP4	SOFTWARE	TYR B:193 , PHE B:250 , TYR B:258 , GLN B:274 , SER B:277 , HIS D:87 , LEU D:162 , LEU D:291 , HOH D:508 , HOH E:212 , TYR H:49 , ASN H:50 , VAL H:60 , SER H:61 , TRP H:62 , HOH H:205 , HOH H:208 , HOH H:209	binding site for residue DGD H 102
122	AP5	SOFTWARE	HTG D:414 , PRO H:23 , GLY H:24 , TRP H:25	binding site for residue DMS H 103
123	AP6	SOFTWARE	TRP A:97 , DMS A:417 , FME I:1 , GLU I:2 , LYS I:5	binding site for residue DMS I 101
124	AP7	SOFTWARE	GLU A:15 , ARG C:262 , CLA C:507 , SER I:25 , GLY I:26 , ARG I:30 , HOH I:201	binding site for residue LMT I 102
125	AP8	SOFTWARE	TYR A:135 , PRO I:28 , ALA I:29 , LYS I:35	binding site for residue DMS I 106
126	AP9	SOFTWARE	DGD C:519 , TYR D:67 , GLY D:70 , CYS D:71 , ASN D:72 , PHE D:73 , ILE F:37 , MET F:40 , GLN F:41 , PHE J:28 , GLY J:31 , ALA J:32 , LEU J:36 , MG J:102 , HOH J:201	binding site for residue LMG J 101
127	AQ1	SOFTWARE	HOH F:201 , GLY J:31 , ALA J:34 , LEU J:36 , LMG J:101	binding site for residue MG J 102
128	AQ2	SOFTWARE	ALA C:55 , GLY C:58 , LEU C:59 , SER C:122 , ALA C:123 , GLY C:126 , CLA C:512 , TYR K:15 , PHE K:32 , SER Z:16	binding site for residue BCR K 101
129	AQ3	SOFTWARE	ASP K:19 , ASP K:23 , HOH K:201 , HOH K:206 , HOH Y:206	binding site for residue MG K 102
130	AQ4	SOFTWARE	SER A:232 , ASN A:234 , PRO B:4 , TRP B:5 , TYR B:6 , TRP D:266 , PHE D:273 , CLA D:401 , PL9 D:406 , LHG D:409 , LHG D:410 , GLU L:11 , LEU L:12 , ASN L:13 , SER L:16 , GLY L:20	binding site for residue LHG L 101
131	AQ5	SOFTWARE	HOH L:205	binding site for residue DMS L 102
132	AQ6	SOFTWARE	THR O:138 , ASN O:200 , VAL O:201 , HOH O:459 , HOH O:533	binding site for residue CA O 302
133	AQ7	SOFTWARE	ASN O:124 , VAL O:126 , GLU O:145 , LYS O:194 , HOH O:474 , HOH O:550	binding site for residue DMS O 303
134	AQ8	SOFTWARE	GLN O:130 , VAL O:133 , THR O:137 , THR O:140	binding site for residue DMS O 304
135	AQ9	SOFTWARE	PRO O:20 , ARG O:42	binding site for residue DMS O 305
136	AR1	SOFTWARE	LYS O:143 , GLN O:196 , SER O:198 , GLU O:216 , GLU O:218	binding site for residue DMS O 306
137	AR2	SOFTWARE	ALA O:111 , PRO b:47 , THR b:84	binding site for residue DMS O 307
138	AR3	SOFTWARE	PHE O:190 , SER O:191 , LEU O:192	binding site for residue DMS O 308
139	AR4	SOFTWARE	THR O:6 , TYR O:7 , ASP O:8 , HOH O:506	binding site for residue DMS O 309
140	AR5	SOFTWARE	THR O:48 , HOH O:427 , HOH O:442 , HOH O:501	binding site for residue DMS O 310
141	AR6	SOFTWARE	ASP B:334 , LYS B:423 , PHE B:432 , HOH B:878 , GLN O:176 , ALA O:177 , LYS O:178	binding site for residue DMS O 311
142	AR7	SOFTWARE	SER O:170 , ALA O:171 , LEU O:174 , ALA O:177 , GLU O:179 , ASN O:186 , HOH O:467	binding site for residue DMS O 312
143	AR8	SOFTWARE	ARG O:184 , ARG O:189 , ASP O:223 , HIS O:228 , GLU O:229	binding site for residue DMS O 313
144	AR9	SOFTWARE	SER O:128 , THR O:129 , GLN O:130 , ASP O:141	binding site for residue DMS O 314
145	AS1	SOFTWARE	LEU A:72 , FME T:1 , HOH T:202 , HOH T:204 , ALA b:43 , THR b:44	binding site for residue LMT T 102
146	AS2	SOFTWARE	VAL U:50 , ALA U:53 , ARG U:97 , DMS U:203 , HOH U:353	binding site for residue DMS U 202
147	AS3	SOFTWARE	ASN U:28 , ALA U:53 , PRO U:54 , VAL U:87 , VAL U:92 , DMS U:202	binding site for residue DMS U 203
148	AS4	SOFTWARE	LEU A:341 , LEU A:343 , MET C:396 , THR C:397 , GLY C:409 , HOH C:636 , LYS V:47	binding site for residue DMS V 201
149	AS5	SOFTWARE	CYS V:37 , CYS V:40 , HIS V:41 , THR V:46 , THR V:48 , LEU V:52 , ASP V:53 , LEU V:54 , THR V:58 , LEU V:59 , ALA V:62 , TYR V:75 , MET V:76 , TYR V:82 , ILE V:88 , HIS V:92 , PRO V:93 , MET V:104 , HOH V:313 , HOH V:315 , HOH V:317 , HOH V:318 , HOH V:350 , HOH V:360	binding site for residue HEM V 202
150	AS6	SOFTWARE	ALA V:89 , ARG V:96 , SER V:97 , ASP V:99	binding site for residue HTG V 203
151	AS7	SOFTWARE	ASP V:128 , DMS V:208	binding site for residue DMS V 204
152	AS8	SOFTWARE	LEU V:3 , PRO V:5 , DMS V:207	binding site for residue DMS V 205
153	AS9	SOFTWARE	HOH A:533 , ARG F:45 , HOH J:210 , LEU V:3 , GLU V:23 , LEU V:27 , DMS V:207	binding site for residue DMS V 206
154	AT1	SOFTWARE	HOH A:533 , ARG F:45 , GLU V:2 , GLU V:23 , DMS V:205 , DMS V:206 , HOH V:380	binding site for residue DMS V 207
155	AT2	SOFTWARE	LYS V:124 , ILE V:125 , DMS V:204	binding site for residue DMS V 208
156	AT3	SOFTWARE	ALA U:33 , ILE U:36 , SER V:51 , HOH V:366	binding site for residue DMS V 209
157	AT4	SOFTWARE	ARG V:31 , LEU V:32 , TYR V:35 , ASN V:106	binding site for residue DMS V 210
158	AT5	SOFTWARE	GLY V:71 , ASP V:74	binding site for residue DMS V 211
159	AT6	SOFTWARE	HIS A:304 , ILE C:414 , LEU V:126 , LYS V:129 , GLY V:133 , TYR V:136 , TYR V:137	binding site for residue DMS V 212
160	AT7	SOFTWARE	SQD C:501 , THR J:15 , GLY J:18 , MET J:19 , LEU K:31 , ALA K:34 , PHE K:37 , VAL K:38 , ILE Y:28 , GLY Y:29 , GLY Y:32 , SER Z:16 , PHE Z:17	binding site for residue BCR Y 101
161	AT8	SOFTWARE	PHE C:127 , TYR C:131 , ARG C:135 , CLA C:514 , TYR Z:27 , TRP Z:33 , LYS Z:37 , TRP Z:47	binding site for residue LMT Z 101
162	AT9	SOFTWARE	GLU a:98	binding site for residue DMS a 401
163	AU1	SOFTWARE	PRO a:57 , PRO a:66 , HOH a:501 , GLU d:310 , ARG o:115	binding site for residue DMS a 402
164	AU2	SOFTWARE	ASP a:61 , ASP a:170 , GLU a:189 , HIS a:332 , GLU a:333 , HIS a:337 , ASP a:342 , ALA a:344 , HOH a:502 , HOH a:506 , HOH a:544 , HOH a:579 , HOH a:597 , HOH a:599 , GLU c:354 , ARG c:357	binding site for residue OEX a 403
165	AU3	SOFTWARE	HIS a:215 , HIS a:272 , BCT a:422 , HIS d:214 , HIS d:268	binding site for residue FE2 a 404
166	AU4	SOFTWARE	ASN a:181 , HIS a:332 , GLU a:333 , LYS d:317 , HOH d:535	binding site for residue CL a 405
167	AU5	SOFTWARE	ASN a:338 , PHE a:339 , HOH a:558 , GLU c:354 , HOH c:1082	binding site for residue CL a 406
168	AU6	SOFTWARE	TYR a:147 , PRO a:150 , SER a:153 , VAL a:157 , MET a:183 , PHE a:186 , GLN a:187 , HIS a:198 , GLY a:201 , PHE a:206 , THR a:286 , ALA a:287 , ILE a:290 , CLA a:408 , CLA a:409 , PHO a:410 , HOH a:564 , LEU d:205 , CLA d:402 , PHE t:17	binding site for residue CLA a 407
169	AU7	SOFTWARE	VAL a:157 , MET a:172 , ILE a:176 , THR a:179 , MET a:183 , CLA a:407 , PHO a:410 , HOH a:567 , HOH a:593 , MET d:198 , VAL d:201 , ALA d:202 , CLA d:402 , PL9 d:405 , HOH d:513 , LHG l:102	binding site for residue CLA a 408
170	AU8	SOFTWARE	GLN a:199 , VAL a:202 , ALA a:203 , PHE a:206 , GLY a:207 , LEU a:210 , TRP a:278 , CLA a:407 , PHO a:411 , HOH a:507 , HOH a:602 , DGD c:919 , VAL d:175 , ILE d:178 , PHE d:179 , LEU d:182 , CLA d:402 , LMG j:101	binding site for residue CLA a 409
171	AU9	SOFTWARE	LEU a:41 , ALA a:44 , THR a:45 , PHE a:48 , TYR a:126 , GLN a:130 , ALA a:146 , TYR a:147 , PRO a:150 , MET a:172 , GLY a:175 , PRO a:279 , CLA a:407 , CLA a:408 , ALA d:208 , LEU d:209 , ILE d:213 , TRP d:253 , PHE d:257	binding site for residue PHO a 410
172	AV1	SOFTWARE	PHE a:206 , ALA a:209 , LEU a:210 , MET a:214 , PHE a:255 , ILE a:259 , CLA a:409 , ALA d:41 , TRP d:48 , ILE d:114 , GLY d:121 , LEU d:122 , PHE d:125 , GLN d:129 , ASN d:142 , PHE d:146 , PRO d:149 , PHE d:153 , CLA d:402	binding site for residue PHO a 411
173	AV2	SOFTWARE	PRO a:39 , THR a:40 , PHE a:93 , PRO a:95 , ILE a:96 , TRP a:97 , GLN a:113 , LEU a:114 , PHE a:117 , HIS a:118 , LEU a:121 , BCR a:413 , CLA c:906 , CLA c:907 , VAL i:8 , TYR i:9 , VAL i:12 , THR i:13 , PHE i:15 , LMG i:101	binding site for residue CLA a 412
174	AV3	SOFTWARE	HTG B:626 , LEU a:42 , ALA a:43 , ILE a:50 , ILE a:96 , CLA a:412 , LHG a:416 , PHE i:15	binding site for residue BCR a 413
175	AV4	SOFTWARE	LEU a:200 , ALA a:203 , GLY a:204 , ASN a:267 , SER a:270 , TRP a:278 , GLY a:282 , GLN c:28 , ALA c:34 , TRP c:35 , TRP c:36 , CLA c:909 , PHE d:232 , ARG d:233 , LHG d:401 , PHE k:37	binding site for residue SQD a 414
176	AV5	SOFTWARE	MET a:214 , HIS a:215 , LEU a:218 , VAL a:219 , HIS a:252 , PHE a:255 , SER a:264 , PHE a:265 , LEU a:271 , VAL d:30 , LEU d:45 , CLA d:403 , ALA f:22 , THR f:25 , THR x:24	binding site for residue PL9 a 415
177	AV6	SOFTWARE	ARG a:16 , PHE a:17 , ASN a:19 , TRP a:20 , SER a:23 , BCR a:413 , HOH a:524 , HOH a:532 , HOH a:539	binding site for residue LHG a 416
178	AV7	SOFTWARE	TRP B:113 , TYR B:117 , BCR B:620 , ARG H:3 , TRP a:20 , ASN a:26 , ARG a:27 , LEU a:28 , PHE t:22	binding site for residue SQD a 418
179	AV8	SOFTWARE	LEU B:39 , ALA B:43 , HTG B:623 , ILE a:53 , LEU a:72 , TYR a:73 , GLY a:74 , DMS a:424 , HOH a:549 , HOH a:576 , ARG d:304 , LMT t:101	binding site for residue LMT a 419
180	AV9	SOFTWARE	TRP a:97 , GLU a:98	binding site for residue DMS a 421
181	AW1	SOFTWARE	HIS a:215 , VAL a:219 , GLU a:244 , HIS a:272 , FE2 a:404 , TYR d:244 , HIS d:268	binding site for residue BCT a 422
182	AW2	SOFTWARE	ASN a:234 , HOH a:530 , HOH a:589 , TYR b:6 , ARG b:7 , LEU b:461 , PHE b:464 , TRP b:468 , CLA b:608 , CLA b:612 , CLA b:614 , TYR d:141 , TRP d:266 , PHE d:269 , LEU d:272 , LHG l:102	binding site for residue LHG a 423
183	AW3	SOFTWARE	GLY a:74 , LMT a:419 , GLN d:301 , ARG d:304	binding site for residue DMS a 424
184	AW4	SOFTWARE	ARG a:64 , GLU a:65 , PRO a:66 , PRO d:309 , GLU d:310 , ARG o:152 , HOH o:500 , HOH o:513	binding site for residue DMS a 425
185	AW5	SOFTWARE	ASN b:438 , HOH b:755 , HOH b:787 , HOH b:861	binding site for residue CA b 601
186	AW6	SOFTWARE	TRP b:185 , GLY b:186 , PHE b:190 , CLA b:603 , HTG b:624 , HOH b:706 , PHE h:41 , RRX h:101	binding site for residue CLA b 602
187	AW7	SOFTWARE	GLY b:189 , PHE b:190 , PRO b:192 , ALA b:200 , HIS b:201 , ALA b:204 , PHE b:247 , PHE b:250 , CLA b:602 , CLA b:604 , CLA b:606 , HOH b:812 , PHE h:41 , ILE h:45 , LEU h:46 , TYR h:49 , DGD h:102	binding site for residue CLA b 603
188	AW8	SOFTWARE	ARG b:68 , LEU b:69 , ALA b:146 , CYS b:150 , PHE b:153 , HIS b:201 , HIS b:202 , PHE b:247 , VAL b:252 , THR b:262 , CLA b:603 , CLA b:605 , CLA b:606 , CLA b:607 , CLA b:610 , HOH b:739 , PHE h:38	binding site for residue CLA b 604
189	AW9	SOFTWARE	TRP b:33 , PHE b:61 , PHE b:65 , ARG b:68 , LEU b:149 , VAL b:245 , ALA b:248 , ALA b:249 , VAL b:252 , PHE b:451 , HIS b:455 , PHE b:458 , PHE b:462 , CLA b:604 , CLA b:606 , CLA b:608 , CLA b:612 , CLA b:613 , CLA b:614 , CLA b:616	binding site for residue CLA b 605
190	AX1	SOFTWARE	THR b:27 , VAL b:30 , ALA b:31 , ALA b:34 , VAL b:62 , PHE b:65 , MET b:66 , ARG b:68 , VAL b:96 , HIS b:100 , LEU b:103 , ALA b:205 , CLA b:603 , CLA b:604 , CLA b:605 , CLA b:607 , CLA b:610 , CLA b:611 , CLA b:616 , BCR b:620 , HOH b:736	binding site for residue CLA b 606
191	AX2	SOFTWARE	LEU b:69 , GLY b:70 , PHE b:90 , TRP b:91 , VAL b:96 , ALA b:99 , HIS b:100 , LEU b:149 , GLY b:152 , PHE b:153 , PHE b:156 , HIS b:157 , PHE b:162 , GLY b:163 , PRO b:164 , CLA b:604 , CLA b:606 , HTG b:627	binding site for residue CLA b 607
192	AX3	SOFTWARE	LHG a:423 , TRP b:33 , MET b:37 , TYR b:40 , GLN b:58 , GLY b:59 , PHE b:61 , LEU b:324 , THR b:327 , GLY b:328 , PRO b:329 , TRP b:450 , CLA b:605 , CLA b:614 , LMG b:622 , HOH b:860 , PHE l:35 , DMS l:104	binding site for residue CLA b 608
193	AX4	SOFTWARE	THR b:236 , SER b:239 , SER b:240 , ALA b:243 , PHE b:463 , HIS b:466 , ILE b:467 , LEU b:474 , CLA b:610 , CLA b:611 , HOH b:808 , PHE d:120 , ILE d:123 , MET d:126 , LEU d:127 , LMG d:409 , LEU h:39	binding site for residue CLA b 609
194	AX5	SOFTWARE	PHE b:139 , VAL b:208 , ALA b:212 , PHE b:215 , HIS b:216 , VAL b:219 , PRO b:221 , PRO b:222 , LEU b:225 , LEU b:229 , CLA b:604 , CLA b:606 , CLA b:609 , CLA b:611 , LMG d:409 , THR h:27 , MET h:31 , PHE h:34 , RRX h:101	binding site for residue CLA b 610
195	AX6	SOFTWARE	LEU b:135 , MET b:138 , PHE b:139 , HIS b:142 , LEU b:143 , MET b:231 , THR b:236 , VAL b:237 , SER b:240 , SER b:241 , CLA b:606 , CLA b:609 , CLA b:610 , CLA b:613 , CLA b:616 , HOH b:737	binding site for residue CLA b 611
196	AX7	SOFTWARE	LHG a:423 , HOH a:530 , TRP b:5 , TYR b:6 , ARG b:7 , VAL b:8 , HIS b:9 , THR b:10 , ILE b:242 , PHE b:462 , GLY b:465 , TRP b:468 , HIS b:469 , ARG b:472 , CLA b:605 , CLA b:613 , CLA b:614 , CLA b:615	binding site for residue CLA b 612
197	AX8	SOFTWARE	HIS b:9 , LEU b:19 , HIS b:23 , HIS b:26 , THR b:27 , ILE b:234 , VAL b:237 , LEU b:238 , SER b:241 , CLA b:605 , CLA b:611 , CLA b:612 , CLA b:614 , CLA b:615 , CLA b:616 , HOH b:753	binding site for residue CLA b 613
198	AX9	SOFTWARE	LHG a:423 , HIS b:9 , HIS b:26 , VAL b:30 , TRP b:33 , PHE b:462 , CLA b:605 , CLA b:608 , CLA b:612 , CLA b:613 , CLA b:615	binding site for residue CLA b 614
199	AY1	SOFTWARE	VAL b:8 , HIS b:9 , LEU b:29 , CLA b:612 , CLA b:613 , CLA b:614 , BCR b:618 , SQD b:621 , GLN l:8 , VAL l:10 , HTG l:106 , HOH l:206	binding site for residue CLA b 615
200	AY2	SOFTWARE	ILE b:20 , HIS b:23 , LEU b:24 , THR b:27 , MET b:138 , HIS b:142 , LEU b:145 , CLA b:605 , CLA b:606 , CLA b:611 , CLA b:613 , CLA b:617 , LEU h:7 , LEU h:14 , ASN h:15	binding site for residue CLA b 616
201	AY3	SOFTWARE	LEU b:24 , TRP b:113 , HIS b:114 , LEU b:120 , CLA b:616 , BCR b:620 , HOH b:818 , THR h:5	binding site for residue CLA b 617
202	AY4	SOFTWARE	PHE T:19 , MET b:25 , LEU b:29 , PHE b:108 , TRP b:115 , CLA b:615 , SQD b:621 , HTG l:106	binding site for residue BCR b 618
203	AY5	SOFTWARE	GLY b:32 , TRP b:33 , SER b:36 , SER b:104 , LEU b:109	binding site for residue BCR b 619
204	AY6	SOFTWARE	PHE T:22 , PHE T:23 , LEU b:106 , LEU b:109 , CLA b:606 , CLA b:617	binding site for residue BCR b 620
205	AY7	SOFTWARE	ARG L:14 , TYR L:18 , PHE T:23 , ARG T:24 , PRO T:26 , ARG b:18 , TRP b:115 , CLA b:615 , BCR b:618 , ASN l:4 , ARG l:7 , HTG l:106	binding site for residue SQD b 621
206	AY8	SOFTWARE	THR b:327 , PRO b:329 , LYS b:332 , CLA b:608 , HOH b:824	binding site for residue LMG b 622
207	AY9	SOFTWARE	DMS A:419 , GLY O:112 , GLY O:113 , SER b:74 , SER b:76 , TRP b:78 , GLU b:94 , LEU b:98 , DMS b:633 , HOH b:778	binding site for residue HTG b 623
208	AZ1	SOFTWARE	TRP b:185 , CLA b:602 , DMS b:637 , ASP o:23 , THR o:25	binding site for residue HTG b 624
209	AZ2	SOFTWARE	ILE A:50 , LEU A:102 , LYS O:69 , TRP b:75 , ASP b:87 , GLY b:89 , PHE b:90 , HTG b:627 , HOH b:745	binding site for residue HTG b 626
210	AZ3	SOFTWARE	ASP b:87 , PHE b:90 , CLA b:607 , HTG b:626	binding site for residue HTG b 627
211	AZ4	SOFTWARE	TRP b:275 , ASP b:276 , SER b:278 , ARG b:358 , PRO b:360 , HOH b:712 , HOH b:734 , HOH d:501	binding site for residue DMS b 629
212	AZ5	SOFTWARE	ARG b:385 , ALA b:386 , SER b:388 , HTG b:632 , LEU u:17 , TYR u:21	binding site for residue DMS b 630
213	AZ6	SOFTWARE	ILE b:13 , PRO b:131 , LEU b:133	binding site for residue DMS b 631
214	AZ7	SOFTWARE	GLU b:387 , LYS b:389 , DMS b:630 , GLU d:343 , ALA u:34 , GLN u:37 , ARG v:55 , ASP v:128 , HOH v:315	binding site for residue HTG b 632
215	AZ8	SOFTWARE	LMT A:414 , ALA b:43 , PHE b:45 , HTG b:623	binding site for residue DMS b 633
216	AZ9	SOFTWARE	SER b:303 , ALA b:304 , ILE b:305	binding site for residue DMS b 634
217	BC1	SOFTWARE	VAL b:377 , LYS b:378 , TYR b:390 , GLN b:395	binding site for residue DMS b 636
218	BC2	SOFTWARE	PRO b:183 , TRP b:185 , HTG b:624 , ASP o:24	binding site for residue DMS b 637
219	BC3	SOFTWARE	HIS b:343 , ALA b:344 , PHE b:346 , LEU b:354 , PHE b:355 , VAL b:356 , HOH b:710 , HOH b:826 , HOH b:867	binding site for residue DMS b 638
220	BC4	SOFTWARE	PHE c:22 , THR c:24 , ASP c:27 , GLU c:29 , SER c:30 , HOH c:1158	binding site for residue CA c 901
221	BC5	SOFTWARE	THR c:94 , LEU c:95 , LEU c:168 , GLY c:171 , ALA c:172 , LEU c:175 , ILE c:224 , VAL c:233 , HIS c:237 , MET c:282 , ILE c:285 , PHE c:289 , TYR c:297 , CLA c:903 , CLA c:904 , CLA c:907 , CLA c:908 , BCR c:916	binding site for residue CLA c 902
222	BC6	SOFTWARE	TRP c:63 , HIS c:91 , GLY c:171 , LEU c:174 , LEU c:279 , MET c:282 , ALA c:286 , VAL c:290 , TYR c:297 , HIS c:430 , LEU c:433 , PHE c:437 , CLA c:902 , CLA c:904 , CLA c:905 , CLA c:911 , CLA c:913	binding site for residue CLA c 903
223	BC7	SOFTWARE	ILE c:60 , VAL c:61 , ALA c:64 , THR c:68 , LEU c:88 , HIS c:91 , HIS c:118 , CLA c:902 , CLA c:903 , CLA c:910 , CLA c:911 , CLA c:913 , LMG c:930	binding site for residue CLA c 904
224	BC8	SOFTWARE	TRP c:63 , MET c:67 , PHE c:70 , GLN c:84 , GLY c:85 , ILE c:87 , TRP c:425 , SER c:429 , HIS c:430 , PHE c:436 , CLA c:903 , CLA c:911 , DGD c:918 , LMG c:920 , HOH c:1061 , HOH c:1166 , LHG d:408 , PRO k:26	binding site for residue CLA c 905
225	BC9	SOFTWARE	LEU a:121 , MET a:127 , TRP a:131 , CLA a:412 , PHE c:264 , SER c:273 , TYR c:274 , GLY c:277 , HIS c:441 , LEU c:442 , ALA c:445 , ARG c:449 , CLA c:908 , BCR c:916 , HOH c:1064 , PHE i:19 , PHE i:23 , LMG i:101	binding site for residue CLA c 906
226	BD1	SOFTWARE	CLA a:412 , LEU c:161 , LEU c:165 , ILE c:243 , GLY c:247 , TRP c:250 , HIS c:251 , THR c:254 , THR c:255 , PRO c:256 , PHE c:257 , TRP c:259 , PHE c:264 , CLA c:902 , CLA c:908 , BCR c:916 , HOH c:1106	binding site for residue CLA c 907
227	BD2	SOFTWARE	MET c:157 , THR c:158 , LEU c:161 , HIS c:164 , LEU c:168 , TRP c:259 , PHE c:264 , TRP c:266 , TYR c:271 , TYR c:274 , SER c:275 , ALA c:278 , MET c:282 , CLA c:902 , CLA c:906 , CLA c:907 , CLA c:910 , HOH c:1017	binding site for residue CLA c 908
228	BD3	SOFTWARE	SQD a:414 , TRP c:36 , ALA c:37 , GLY c:38 , ASN c:39 , ALA c:40 , GLU c:269 , LEU c:272 , LEU c:276 , PHE c:436 , PHE c:437 , GLY c:440 , TRP c:443 , HIS c:444 , ARG c:447 , CLA c:910 , CLA c:911 , CLA c:912 , DGD c:918 , LHG d:408	binding site for residue CLA c 909
229	BD4	SOFTWARE	ASN c:39 , LEU c:49 , ALA c:52 , HIS c:53 , HIS c:56 , TYR c:149 , GLY c:268 , GLU c:269 , TYR c:271 , LEU c:272 , SER c:275 , LEU c:276 , CLA c:904 , CLA c:908 , CLA c:909 , CLA c:911 , CLA c:912 , CLA c:913	binding site for residue CLA c 910
230	BD5	SOFTWARE	ASN c:39 , HIS c:56 , LEU c:59 , TRP c:63 , LEU c:279 , PHE c:436 , PHE c:437 , CLA c:903 , CLA c:904 , CLA c:905 , CLA c:909 , CLA c:910 , CLA c:912 , PRO k:29 , LEU k:33	binding site for residue CLA c 911
231	BD6	SOFTWARE	ARG c:26 , TRP c:35 , GLY c:38 , ASN c:39 , ARG c:41 , LEU c:42 , LEU c:45 , LYS c:48 , ALA c:52 , ALA c:123 , GLY c:126 , PHE c:127 , ILE c:134 , CLA c:909 , CLA c:910 , CLA c:911 , HOH c:1055 , PHE k:32 , LEU k:33 , ALA k:36 , TRP k:39 , GLN k:40 , BCR k:101 , ASN y:45 , LEU y:46 , MET z:19 , VAL z:20 , PRO z:24 , ALA z:28	binding site for residue CLA c 912
232	BD7	SOFTWARE	LEU c:50 , HIS c:53 , ALA c:57 , LEU c:125 , PHE c:146 , PHE c:147 , PHE c:163 , HIS c:164 , VAL c:167 , ILE c:170 , GLY c:171 , CLA c:903 , CLA c:904 , CLA c:910 , CLA c:914 , BCR c:915	binding site for residue CLA c 913
233	BD8	SOFTWARE	VAL c:54 , VAL c:124 , GLY c:128 , TYR c:131 , HIS c:132 , PRO c:137 , TYR c:143 , PHE c:147 , CLA c:913 , BCR c:915 , LMT c:931 , HOH c:1141	binding site for residue CLA c 914
234	BD9	SOFTWARE	PHE c:112 , ILE c:120 , SER c:121 , VAL c:124 , PHE c:147 , CLA c:913 , CLA c:914 , TYR k:15 , GLY z:55 , ASN z:58 , PHE z:59	binding site for residue BCR c 915
235	BE1	SOFTWARE	PHE c:210 , TYR c:212 , LEU c:213 , GLY c:236 , HIS c:237 , ILE c:240 , PHE c:264 , CLA c:902 , CLA c:906 , CLA c:907 , PHE i:23	binding site for residue BCR c 916
236	BE2	SOFTWARE	LEU a:91 , SER a:148 , ALA a:152 , PHE a:155 , ILE a:163 , PRO c:217 , GLY c:219 , GLY c:220 , GLU c:221 , GLY c:222 , TRP c:223 , SER c:226 , VAL c:227 , CYS c:288 , PHE c:292 , ASN c:293 , ASN c:294 , THR c:295 , ASP c:360 , PHE c:361 , ARG c:362 , LEU c:438 , HOH c:1020 , HOH c:1036 , HOH c:1048 , HOH c:1080 , HOH c:1088 , HOH c:1134 , LMG i:101	binding site for residue DGD c 917
237	BE3	SOFTWARE	PHE a:197 , GLU c:83 , GLN c:84 , GLY c:85 , SER c:406 , ASN c:418 , PHE c:419 , VAL c:420 , TRP c:425 , SER c:429 , CLA c:905 , CLA c:909 , DGD c:919 , LMG c:920 , HOH c:1010 , HOH c:1085 , HOH c:1121 , HOH c:1126 , PHE j:29 , TYR j:33	binding site for residue DGD c 918
238	BE4	SOFTWARE	PRO a:196 , GLN a:199 , LEU a:200 , TRP a:278 , PHE a:300 , ASN a:301 , PHE a:302 , SER a:305 , CLA a:409 , ASN c:405 , VAL c:407 , ASN c:415 , SER c:416 , ASN c:418 , DGD c:918 , HOH c:1044 , HOH c:1094 , HOH c:1149 , LHG d:408 , PHE j:29 , ALA j:32 , TYR j:33 , GLY j:37 , SER j:38 , SER j:39 , LMG j:101 , HOH j:202	binding site for residue DGD c 919
239	BE5	SOFTWARE	HIS c:74 , GLN c:84 , CLA c:905 , DGD c:918 , DMS c:936 , HOH c:1007 , VAL k:27 , VAL k:30	binding site for residue LMG c 920
240	BE6	SOFTWARE	ASN a:12 , TRP a:14 , GLU a:15 , TRP c:259 , ARG c:262 , HOH c:1030 , SER i:25 , GLY i:26 , ARG i:30	binding site for residue LMT c 921
241	BE7	SOFTWARE	TRP c:97 , PHE c:182 , LMG c:930	binding site for residue HTG c 922
242	BE8	SOFTWARE	TRP c:189 , ASN c:228 , ARG c:362 , HOH c:1020	binding site for residue DMS c 923
243	BE9	SOFTWARE	GLY c:220 , ASP c:360 , ARG c:362 , HOH c:1006 , TYR o:7	binding site for residue DMS c 924
244	BF1	SOFTWARE	GLU c:394 , HOH c:1013 , ILE v:100	binding site for residue DMS c 925
245	BF2	SOFTWARE	GLU c:78 , PRO c:80 , GLY c:102 , GLY c:103 , GLU c:300	binding site for residue DMS c 926
246	BF3	SOFTWARE	GLU c:104 , ASP v:99 , ARG v:105	binding site for residue DMS c 927
247	BF4	SOFTWARE	GLY c:192 , TRP c:387 , ARG c:391	binding site for residue DMS c 928
248	BF5	SOFTWARE	TRP c:189 , PRO c:364 , GLU c:367 , PRO c:368	binding site for residue DMS c 929
249	BF6	SOFTWARE	TRP c:97 , ASP c:107 , PHE c:109 , PRO c:110 , VAL c:113 , VAL c:114 , VAL c:117 , HIS c:118 , SER c:121 , CLA c:904 , HTG c:922 , HOH c:1037 , HOH c:1099	binding site for residue LMG c 930
250	BF7	SOFTWARE	PHE c:127 , ARG c:135 , CLA c:914 , HOH c:1024 , TYR z:27 , TRP z:33 , LYS z:37 , PHE z:41 , TRP z:47	binding site for residue LMT c 931
251	BF8	SOFTWARE	LYS c:323 , HOH c:1049 , GLN v:86 , GLU v:90 , VAL v:91	binding site for residue DMS c 933
252	BF9	SOFTWARE	THR c:254 , THR c:255 , PHE c:257	binding site for residue DMS c 934
253	BG1	SOFTWARE	LYS c:48 , ILE c:134 , ARG c:135 , GLY c:136 , GLU c:138	binding site for residue DMS c 935
254	BG2	SOFTWARE	LMG c:920	binding site for residue DMS c 936
255	BG3	SOFTWARE	SER c:216 , DMS c:942 , LMG i:101	binding site for residue DMS c 937
256	BG4	SOFTWARE	ASP c:150 , LYS c:152 , ASP c:153 , HOH c:1145	binding site for residue DMS c 938
257	BG5	SOFTWARE	SER c:145 , PHE c:146 , LYS c:156 , THR c:159 , HOH c:1135	binding site for residue DMS c 939
258	BG6	SOFTWARE	ASP c:195 , VAL c:196 , HOH c:1150 , HOH c:1203	binding site for residue DMS c 940
259	BG7	SOFTWARE	GLU c:141 , GLU c:142 , TYR c:143 , SER c:144 , SER c:145	binding site for residue DMS c 941
260	BG8	SOFTWARE	DMS c:937	binding site for residue DMS c 942
261	BG9	SOFTWARE	PRO c:77 , VAL c:105 , VAL c:106 , ASP c:107	binding site for residue DMS c 943
262	BH1	SOFTWARE	SER c:468 , MET c:469	binding site for residue DMS c 944
263	BH2	SOFTWARE	SQD a:414 , TRP c:35 , ARG d:233 , GLY k:44 , PHE k:45	binding site for residue LHG d 401
264	BH3	SOFTWARE	MET a:183 , CLA a:407 , CLA a:408 , CLA a:409 , PHO a:411 , PRO d:149 , VAL d:152 , SER d:155 , VAL d:156 , PHE d:181 , LEU d:182 , PHE d:185 , GLN d:186 , TRP d:191 , THR d:192 , HIS d:197 , GLY d:200 , VAL d:201 , LEU d:205 , SER d:282 , ALA d:283	binding site for residue CLA d 402
265	BH4	SOFTWARE	PL9 a:415 , CYS d:40 , LEU d:43 , LEU d:89 , LEU d:90 , LEU d:91 , LEU d:92 , TRP d:93 , TRP d:104 , THR d:112 , PHE d:113 , LEU d:116 , HIS d:117 , PHE x:11 , GLY x:13 , LEU x:14 , LEU x:15	binding site for residue CLA d 403
266	BH5	SOFTWARE	TYR d:42 , LEU d:43 , GLY d:46 , GLY d:47 , LEU d:49 , THR d:50 , PRO f:29 , THR f:30 , LEU f:34 , VAL j:25 , LMG j:101	binding site for residue BCR d 404
267	BH6	SOFTWARE	PHE a:52 , ILE a:53 , CLA a:408 , MET d:199 , ALA d:202 , HIS d:214 , THR d:217 , MET d:246 , ALA d:249 , ASN d:250 , TRP d:253 , ALA d:260 , PHE d:261 , LEU d:267 , PHE d:270 , PHE d:273 , GLY d:278 , LEU l:23 , VAL l:26 , LEU l:29 , LHG l:102 , PHE t:10	binding site for residue PL9 d 405
268	BH7	SOFTWARE	GLY d:99 , PHE d:101 , THR d:102 , PHE e:37	binding site for residue DGD d 406
269	BH8	SOFTWARE	MET a:37 , PHE d:257 , ALA d:260 , PHE d:261 , SER d:262 , ASN d:263 , TRP d:266 , PHE d:270 , ASN l:13 , THR l:15 , TYR l:18 , LEU l:19 , LHG l:102 , HOH l:201 , PHE t:17 , ALA t:20 , HOH t:204	binding site for residue LHG d 407
270	BH9	SOFTWARE	ARG a:140 , TRP a:142 , PHE a:273 , TRP a:284 , TRP c:36 , TRP c:443 , ARG c:447 , CLA c:905 , CLA c:909 , DGD c:919 , GLU d:219 , ASN d:220 , ALA d:229 , SER d:230 , THR d:231 , PHE d:232	binding site for residue LHG d 408
271	BI1	SOFTWARE	LEU b:474 , CLA b:609 , CLA b:610 , LYS d:23 , TRP d:32 , LEU d:135 , HOH d:595 , MET h:35 , GLY h:36 , LEU x:21 , PHE x:25	binding site for residue LMG d 409
272	BI2	SOFTWARE	ASN a:315 , HIS d:61 , GLN d:332 , ILE e:63	binding site for residue DMS d 411
273	BI3	SOFTWARE	VAL d:340 , PHE d:341 , HOH d:526 , VAL v:135 , TYR v:136	binding site for residue DMS d 412
274	BI4	SOFTWARE	PRO d:140 , TYR d:141 , ILE d:144	binding site for residue DMS d 413
275	BI5	SOFTWARE	GLN d:224 , GLY d:226 , GLU d:227	binding site for residue DMS d 414
276	BI6	SOFTWARE	ARG b:357 , HOH b:910 , ASN d:338 , PHE d:339 , VAL d:340	binding site for residue DMS d 415
277	BI7	SOFTWARE	ILE e:13 , TYR e:19 , ILE e:22 , HIS e:23 , THR e:26 , HOH e:205 , ARG f:19 , TRP f:20 , VAL f:23 , HIS f:24 , ALA f:27 , ILE f:31	binding site for residue HEM e 101
278	BI8	SOFTWARE	TRP d:21 , ARG d:26 , PHE f:16 , THR f:17 , VAL f:18 , VAL f:21 , ASP x:35	binding site for residue SQD f 101
279	BI9	SOFTWARE	GLN f:44 , ARG f:45 , GLY j:35 , SER j:38 , LEU j:40 , DMS v:206	binding site for residue DMS f 103
280	BJ1	SOFTWARE	CLA b:602 , CLA b:610 , PHE h:34 , LEU h:37 , PHE h:38 , PHE h:41 , ILE h:44 , THR x:2	binding site for residue RRX h 101
281	BJ2	SOFTWARE	TYR b:193 , TYR b:258 , TYR b:273 , GLN b:274 , SER b:277 , PHE b:463 , CLA b:603 , HOH b:788 , GLY d:86 , HIS d:87 , ILE d:123 , ILE d:159 , LEU d:162 , TYR h:49 , ASN h:50 , VAL h:60 , SER h:61 , TRP h:62 , HOH h:202 , HOH h:206 , HOH h:219 , HOH h:220	binding site for residue DGD h 102
282	BJ3	SOFTWARE	PHE a:93 , TRP a:97 , GLU a:98 , LEU a:121 , CLA a:412 , LEU c:214 , SER c:216 , GLU c:221 , PHE c:284 , CLA c:906 , DGD c:917 , DMS c:937 , LYS i:5 , TYR i:9 , HOH i:201	binding site for residue LMG i 101
283	BJ4	SOFTWARE	TYR a:135 , ILE c:265 , ALA c:452 , PRO i:28 , ARG i:34 , ASP i:36	binding site for residue DMS i 106
284	BJ5	SOFTWARE	CLA a:409 , DGD c:919 , TYR d:67 , GLY d:70 , CYS d:71 , ASN d:72 , PHE d:73 , BCR d:404 , THR f:30 , ILE f:37 , MET f:40 , GLN f:41 , PHE j:28 , GLY j:31 , ALA j:32 , LEU j:36 , MG j:102 , HOH j:202	binding site for residue LMG j 101
285	BJ6	SOFTWARE	HOH f:201 , GLY j:31 , ALA j:34 , LEU j:36 , LMG j:101	binding site for residue MG j 102
286	BJ7	SOFTWARE	GLY c:58 , LEU c:59 , VAL c:116 , ILE c:120 , ALA c:123 , CLA c:912 , PHE k:32 , TRP k:39 , BCR y:101 , LEU z:9 , SER z:16	binding site for residue BCR k 101
287	BJ8	SOFTWARE	ASP k:19 , ASP k:23 , HOH k:201 , HOH k:206 , HOH k:207	binding site for residue MG k 102
288	BJ9	SOFTWARE	ARG B:18 , SER B:104 , TRP B:115 , CLA B:615 , BCR B:618 , ARG L:7 , ARG l:14 , TYR l:18 , HOH l:208 , CYS t:12 , PHE t:19 , PHE t:23 , ARG t:24	binding site for residue SQD l 101
289	BK1	SOFTWARE	SER a:232 , ASN a:234 , CLA a:408 , LHG a:423 , PRO b:4 , TRP b:5 , TYR b:6 , ALA d:202 , TRP d:266 , PHE d:273 , PL9 d:405 , LHG d:407 , GLU l:11 , LEU l:12 , ASN l:13 , SER l:16 , GLY l:20	binding site for residue LHG l 102
290	BK2	SOFTWARE	DMS l:104	binding site for residue DMS l 103
291	BK3	SOFTWARE	CLA b:608 , PHE l:35 , DMS l:103	binding site for residue DMS l 104
292	BK4	SOFTWARE	TRP b:115 , CLA b:615 , BCR b:618 , SQD b:621 , ARG l:7 , HOH l:206	binding site for residue HTG l 106
293	BK5	SOFTWARE	THR o:138 , ASN o:200 , VAL o:201 , HOH o:416 , HOH o:441 , HOH o:447 , HOH o:489	binding site for residue CA o 301
294	BK6	SOFTWARE	THR o:48 , PHE o:50 , LEU o:70 , HOH o:459 , HOH o:473	binding site for residue DMS o 302
295	BK7	SOFTWARE	LYS o:53 , GLU o:55 , MET o:110 , GLU o:114 , HIS o:231	binding site for residue DMS o 303
296	BK8	SOFTWARE	PHE b:432 , HOH b:704 , HOH b:829 , GLN o:176 , LYS o:178	binding site for residue DMS o 304
297	BK9	SOFTWARE	TYR o:30 , THR o:208 , PRO o:245	binding site for residue DMS o 305
298	BL1	SOFTWARE	ASN o:124 , VAL o:126 , ASN o:147 , LYS o:194	binding site for residue DMS o 306
299	BL2	SOFTWARE	SER o:170 , ALA o:171 , LEU o:174 , ALA o:177 , LYS o:178 , GLU o:179 , ASN o:186	binding site for residue DMS o 307
300	BL3	SOFTWARE	ARG o:184 , ARG o:189 , LEU u:9 , HOH u:374	binding site for residue DMS o 308
301	BL4	SOFTWARE	TYR B:40 , ALA B:43 , LMT a:419 , FME t:1 , DMS t:103 , HOH t:201	binding site for residue LMT t 101
302	BL5	SOFTWARE	DMS B:634 , LMT t:101	binding site for residue DMS t 103
303	BL6	SOFTWARE	THR t:5 , DMS t:105	binding site for residue DMS t 104
304	BL7	SOFTWARE	FME t:1 , THR t:5 , DMS t:104	binding site for residue DMS t 105
305	BL8	SOFTWARE	VAL u:50 , ALA u:53 , ARG u:97 , DMS u:203 , DMS u:205	binding site for residue DMS u 202
306	BL9	SOFTWARE	GLU u:93 , DMS u:202 , DMS u:205	binding site for residue DMS u 203
307	BM1	SOFTWARE	TYR u:55 , GLU u:56 , ASP u:60 , HOH u:343	binding site for residue DMS u 204
308	BM2	SOFTWARE	ASN u:28 , PRO u:54 , VAL u:87 , DMS u:202 , DMS u:203	binding site for residue DMS u 205
309	BM3	SOFTWARE	LEU a:341 , LEU a:343 , MET c:396 , THR c:397 , ALA c:399 , GLY c:409 , LYS v:47	binding site for residue DMS v 201
310	BM4	SOFTWARE	ASN v:13 , SER v:14 , PRO v:64 , PRO v:65 , ASN v:68 , GLU v:70 , GLY v:71 , ASP v:74	binding site for residue HTG v 203
311	BM5	SOFTWARE	GLY v:127 , ASP v:128 , DMS v:208	binding site for residue DMS v 204
312	BM6	SOFTWARE	GLU v:2 , LEU v:3 , THR v:4	binding site for residue DMS v 205
313	BM7	SOFTWARE	ARG f:45 , DMS f:103 , LEU v:3 , GLU v:23 , LEU v:27	binding site for residue DMS v 206
314	BM8	SOFTWARE	GLU v:2 , GLU v:23	binding site for residue DMS v 207
315	BM9	SOFTWARE	GLY v:127 , DMS v:204	binding site for residue DMS v 208
316	BN1	SOFTWARE	SER v:14 , GLY v:16 , ASP v:67	binding site for residue DMS v 209
317	BN2	SOFTWARE	HIS a:304 , GLY v:43 , LEU v:126 , LYS v:129 , TYR v:137 , HOH v:370	binding site for residue DMS v 210
318	BN3	SOFTWARE	ALA u:33 , LYS u:104 , SER v:51	binding site for residue DMS v 211
319	BN4	SOFTWARE	PHE c:62 , ALA j:14 , THR j:15 , GLY j:18 , MET j:19 , LEU k:21 , LEU k:31 , PHE k:32 , ALA k:34 , PHE k:37 , VAL k:38 , BCR k:101 , ILE y:28 , GLY y:29 , GLY y:32 , PHE z:17	binding site for residue BCR y 101
320	BN5	SOFTWARE	ALA v:36 , CYS v:37 , ALA v:38 , SER v:39 , HIS v:41 , VAL v:42 , ILE v:45 , THR v:46 , LYS v:47 , THR v:48 , LEU v:52 , ASP v:53 , LEU v:54 , THR v:58 , LEU v:59 , LEU v:72 , TYR v:75 , MET v:76 , TYR v:82 , ILE v:88 , HIS v:92 , PRO v:93 , MET v:104 , ILE v:115 , HOH v:304 , HOH v:305 , HOH v:320 , HOH v:327 , HOH v:329 , HOH v:330	binding site for Di-peptide HEM v 202 and CYS v 40
321	BN6	SOFTWARE	PHE v:33 , ALA v:36 , ALA v:38 , SER v:39 , CYS v:40 , HIS v:41 , THR v:46 , THR v:48 , LEU v:52 , ASP v:53 , LEU v:54 , THR v:58 , LEU v:59 , LEU v:72 , TYR v:75 , MET v:76 , TYR v:82 , ILE v:88 , HIS v:92 , PRO v:93 , MET v:104 , ILE v:115 , HOH v:304 , HOH v:305 , HOH v:320 , HOH v:327 , HOH v:329 , HOH v:330	binding site for Di-peptide HEM v 202 and CYS v 37

SS Bonds (2, 2)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:334
                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.........................ee............hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhh.........hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee.................hhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f A  11 ANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA 344
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340

Chain B from PDB  Type:PROTEIN  Length:505
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhh...hhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.........hhhhhhhhhhhhhhhhhhhhhhh.........eee........eee......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh.hhhhhhhhhhhhh..........hhhhh..eeeeeeeeeeee.....eeee............eee.....eeee..........hhhhhh.eeeee.......ee.hhhhhhhhhhhhh...eeeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhh.........hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f B   2 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRR 506
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501

Chain C from PDB  Type:PROTEIN  Length:451
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhh...hhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee.......eee.......hhhhhhhhhhh......hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhhhhhhhhhhhh................eee.....eee.hhhhhhh......hhh.ee..eehhhhhhhh.hhhhhhhhhhhhh....ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f C  23 ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD 473
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472

Chain D from PDB  Type:PROTEIN  Length:342
                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh...hhhhh......ee...hhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5h2f D  11 ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 352
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350

Chain E from PDB  Type:PROTEIN  Length:79
                                                                                                               
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------- Transcript
                 5h2f E   5 TGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL  83
                                    14        24        34        44        54        64        74

Chain F from PDB  Type:PROTEIN  Length:33
                                                                 
               SCOP domains --------------------------------- SCOP domains
               CATH domains --------------------------------- CATH domains
               Pfam domains --------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------- PROSITE
                 Transcript --------------------------------- Transcript
                 5h2f F  13 YPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR  45
                                    22        32        42

Chain H from PDB  Type:PROTEIN  Length:63
                                                                                               
               SCOP domains --------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------- Transcript
                 5h2f H   2 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA  64
                                    11        21        31        41        51        61

Chain I from PDB  Type:PROTEIN  Length:35
                                                                   
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                 5h2f I   1 mETLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK  35
                            |       10        20        30     
                            1-FME

Chain J from PDB  Type:PROTEIN  Length:36
                                                                    
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                 5h2f J   5 GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL  40
                                    14        24        34

Chain K from PDB  Type:PROTEIN  Length:37
                                                                     
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                 5h2f K  10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR  46
                                    19        29        39

Chain L from PDB  Type:PROTEIN  Length:35
                                                                   
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author .......ee.hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                 5h2f L   3 PNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN  37
                                    12        22        32

Chain O from PDB  Type:PROTEIN  Length:243
                                                                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhh...........ee......eeeeeeeeeeeeeeee...........eee.ee.......eeeeeeeeee.....eeeeeeeee.eeeeeee.....eeeeeee....eee......ee....eeeeeeeee.............................hhhhhhhhh....eeeeeeeeeeeee.....eeeeeeeeeee..hhhhh....eeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f O   4 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA 246
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243

Chain T from PDB  Type:PROTEIN  Length:30
                                                              
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                 5h2f T   1 mETITYVFIFACIIALFFFAIFFREPPRIT  30
                            |       10        20        30
                            1-FME

Chain U from PDB  Type:PROTEIN  Length:97
                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh.ee....hhhhhhhh....hhhhhhhhhh....hhhhhhhh...hhhhhhhhhhhh..ee....hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 5h2f U   8 ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK 104
                                    17        27        37        47        57        67        77        87        97

Chain V from PDB  Type:PROTEIN  Length:137
                                                                                                                                                                         
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee......eee.hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhh.....hhhhhhhhhhh...............hhhhh..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh..hhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f V   1 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY 137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain X from PDB  Type:PROTEIN  Length:37
                                                                     
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                 5h2f X   2 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQ  38
                                    11        21        31

Chain Y from PDB  Type:PROTEIN  Length:29
                                                             
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 5h2f Y  18 VIAQLTMIAMIGIAGPMIIFLLAVRRGNL  46
                                    27        37

Chain Z from PDB  Type:PROTEIN  Length:62
                                                                                              
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                 5h2f Z   1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV  62
                                    10        20        30        40        50        60

Chain a from PDB  Type:PROTEIN  Length:334
                                                                                                                                                                                                                                                                                                                                                                              
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhh.........................ee............hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhh.........hhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee.................hhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f a  11 ANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA 344
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340

Chain b from PDB  Type:PROTEIN  Length:483
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhh...hhhhhhhh......................hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.........hhhhhhhhhhhhhhhhhhhhhhh.........eee........eee......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh.hhhhhhhhhhhhh..........hhhhh..eeeeeeeeeeee.....eeee............eee.....eeee.................eeeee.......ee.hhhhhhhhhhhhh...eeeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f b   2 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDP 484
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481

Chain c from PDB  Type:PROTEIN  Length:455
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhh..hhhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee.......eee.......hhhhhhhhhhh......hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhhhhhhhhhhhh................eee.....eee.hhhhhhh......hhh.ee..eehhhhhhhh.hhhhhhhhhhhhh....ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f c  19 NSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD 473
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468

Chain d from PDB  Type:PROTEIN  Length:341
                                                                                                                                                                                                                                                                                                                                                                                     
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhh...hhhhh......ee...hhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhh...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f d  12 RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 352
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351

Chain e from PDB  Type:PROTEIN  Length:79
                                                                                                               
               SCOP domains ------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......................hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------- Transcript
                 5h2f e   6 GERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK  84
                                    15        25        35        45        55        65        75

Chain f from PDB  Type:PROTEIN  Length:31
                                                               
               SCOP domains ------------------------------- SCOP domains
               CATH domains ------------------------------- CATH domains
               Pfam domains ------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------- PROSITE
                 Transcript ------------------------------- Transcript
                 5h2f f  15 IFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR  45
                                    24        34        44

Chain h from PDB  Type:PROTEIN  Length:62
                                                                                              
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                 5h2f h   2 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWK  63
                                    11        21        31        41        51        61

Chain i from PDB  Type:PROTEIN  Length:36
                                                                    
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                 5h2f i   1 mETLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKD  36
                            |       10        20        30      
                            1-FME

Chain j from PDB  Type:PROTEIN  Length:40
                                                                        
               SCOP domains ---------------------------------------- SCOP domains
               CATH domains ---------------------------------------- CATH domains
               Pfam domains ---------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------- PROSITE
                 Transcript ---------------------------------------- Transcript
                 5h2f j   1 MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL  40
                                    10        20        30        40

Chain k from PDB  Type:PROTEIN  Length:37
                                                                     
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                 5h2f k  10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR  46
                                    19        29        39

Chain l from PDB  Type:PROTEIN  Length:35
                                                                   
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains ----------------------------------- Pfam domains
         Sec.struct. author .......ee.hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                 5h2f l   3 PNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN  37
                                    12        22        32

Chain o from PDB  Type:PROTEIN  Length:243
                                                                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh..hhhhh...........ee......eeeeeeeeeeeeeeee...........eee.ee.......eeeeeeeeee.....eeee..eee.eeeeeee.....eeeeeee....eee......ee....eeeeeeeee.............................hhhhhhhhh....eeeeeeeeeeeeee....eeeeeeeeeee...........eeeeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f o   4 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA 246
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243

Chain t from PDB  Type:PROTEIN  Length:30
                                                              
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains ------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                 5h2f t   1 mETITYVFIFACIIALFFFAIFFREPPRIT  30
                            |       10        20        30
                            1-FME

Chain u from PDB  Type:PROTEIN  Length:97
                                                                                                                                 
               SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhh.ee....hhhhhhhh....hhhhhhhhhhh...hhhhhhhh...hhhhhhhhhhhh..ee....hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 5h2f u   8 ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK 104
                                    17        27        37        47        57        67        77        87        97

Chain v from PDB  Type:PROTEIN  Length:137
                                                                                                                                                                         
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....................hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhh......hhhhhhhhhhh...............hhhhh..hhhhh..hhhhhhhhhhhhhhhhhhhhhhh..hhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5h2f v   1 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY 137
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain x from PDB  Type:PROTEIN  Length:36
                                                                    
               SCOP domains ------------------------------------ SCOP domains
               CATH domains ------------------------------------ CATH domains
               Pfam domains ------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------ PROSITE
                 Transcript ------------------------------------ Transcript
                 5h2f x   2 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKV  37
                                    11        21        31

Chain y from PDB  Type:PROTEIN  Length:29
                                                             
               SCOP domains ----------------------------- SCOP domains
               CATH domains ----------------------------- CATH domains
               Pfam domains ----------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------- SAPs(SNPs)
                    PROSITE ----------------------------- PROSITE
                 Transcript ----------------------------- Transcript
                 5h2f y  18 VIAQLTMIAMIGIAGPMIIFLLAVRRGNL  46
                                    27        37

Chain z from PDB  Type:PROTEIN  Length:61
                                                                                             
               SCOP domains ------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------- Transcript
                 5h2f z   1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFV  61
                                    10        20        30        40        50        60

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (30, 184)

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BCR	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		BCT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CLA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		DGD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		DMS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FE2	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		FME	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		HTG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		LHG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		LMG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		LMT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		OEX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PHO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PL9	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		RRX	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SQD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		UNL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]
		AD6	[ RasMol ]	+environment [ RasMol ]
		AD7	[ RasMol ]	+environment [ RasMol ]
		AD8	[ RasMol ]	+environment [ RasMol ]
		AD9	[ RasMol ]	+environment [ RasMol ]
		AE1	[ RasMol ]	+environment [ RasMol ]
		AE2	[ RasMol ]	+environment [ RasMol ]
		AE3	[ RasMol ]	+environment [ RasMol ]
		AE4	[ RasMol ]	+environment [ RasMol ]
		AE5	[ RasMol ]	+environment [ RasMol ]
		AE6	[ RasMol ]	+environment [ RasMol ]
		AE7	[ RasMol ]	+environment [ RasMol ]
		AE8	[ RasMol ]	+environment [ RasMol ]
		AE9	[ RasMol ]	+environment [ RasMol ]
		AF1	[ RasMol ]	+environment [ RasMol ]
		AF2	[ RasMol ]	+environment [ RasMol ]
		AF3	[ RasMol ]	+environment [ RasMol ]
		AF4	[ RasMol ]	+environment [ RasMol ]
		AF5	[ RasMol ]	+environment [ RasMol ]
		AF6	[ RasMol ]	+environment [ RasMol ]
		AF7	[ RasMol ]	+environment [ RasMol ]
		AF8	[ RasMol ]	+environment [ RasMol ]
		AF9	[ RasMol ]	+environment [ RasMol ]
		AG1	[ RasMol ]	+environment [ RasMol ]
		AG2	[ RasMol ]	+environment [ RasMol ]
		AG3	[ RasMol ]	+environment [ RasMol ]
		AG4	[ RasMol ]	+environment [ RasMol ]
		AG5	[ RasMol ]	+environment [ RasMol ]
		AG6	[ RasMol ]	+environment [ RasMol ]
		AG7	[ RasMol ]	+environment [ RasMol ]
		AG8	[ RasMol ]	+environment [ RasMol ]
		AG9	[ RasMol ]	+environment [ RasMol ]
		AH1	[ RasMol ]	+environment [ RasMol ]
		AH2	[ RasMol ]	+environment [ RasMol ]
		AH3	[ RasMol ]	+environment [ RasMol ]
		AH4	[ RasMol ]	+environment [ RasMol ]
		AH5	[ RasMol ]	+environment [ RasMol ]
		AH6	[ RasMol ]	+environment [ RasMol ]
		AH7	[ RasMol ]	+environment [ RasMol ]
		AH8	[ RasMol ]	+environment [ RasMol ]
		AH9	[ RasMol ]	+environment [ RasMol ]
		AI1	[ RasMol ]	+environment [ RasMol ]
		AI2	[ RasMol ]	+environment [ RasMol ]
		AI3	[ RasMol ]	+environment [ RasMol ]
		AI4	[ RasMol ]	+environment [ RasMol ]
		AI5	[ RasMol ]	+environment [ RasMol ]
		AI6	[ RasMol ]	+environment [ RasMol ]
		AI7	[ RasMol ]	+environment [ RasMol ]
		AI8	[ RasMol ]	+environment [ RasMol ]
		AI9	[ RasMol ]	+environment [ RasMol ]
		AJ1	[ RasMol ]	+environment [ RasMol ]
		AJ2	[ RasMol ]	+environment [ RasMol ]
		AJ3	[ RasMol ]	+environment [ RasMol ]
		AJ4	[ RasMol ]	+environment [ RasMol ]
		AJ5	[ RasMol ]	+environment [ RasMol ]
		AJ6	[ RasMol ]	+environment [ RasMol ]
		AJ7	[ RasMol ]	+environment [ RasMol ]
		AJ8	[ RasMol ]	+environment [ RasMol ]
		AJ9	[ RasMol ]	+environment [ RasMol ]
		AK1	[ RasMol ]	+environment [ RasMol ]
		AK2	[ RasMol ]	+environment [ RasMol ]
		AK3	[ RasMol ]	+environment [ RasMol ]
		AK4	[ RasMol ]	+environment [ RasMol ]
		AK5	[ RasMol ]	+environment [ RasMol ]
		AK6	[ RasMol ]	+environment [ RasMol ]
		AK7	[ RasMol ]	+environment [ RasMol ]
		AK8	[ RasMol ]	+environment [ RasMol ]
		AK9	[ RasMol ]	+environment [ RasMol ]
		AL1	[ RasMol ]	+environment [ RasMol ]
		AL2	[ RasMol ]	+environment [ RasMol ]
		AL3	[ RasMol ]	+environment [ RasMol ]
		AL4	[ RasMol ]	+environment [ RasMol ]
		AL5	[ RasMol ]	+environment [ RasMol ]
		AL6	[ RasMol ]	+environment [ RasMol ]
		AL7	[ RasMol ]	+environment [ RasMol ]
		AL8	[ RasMol ]	+environment [ RasMol ]
		AL9	[ RasMol ]	+environment [ RasMol ]
		AM1	[ RasMol ]	+environment [ RasMol ]
		AM2	[ RasMol ]	+environment [ RasMol ]
		AM3	[ RasMol ]	+environment [ RasMol ]
		AM4	[ RasMol ]	+environment [ RasMol ]
		AM5	[ RasMol ]	+environment [ RasMol ]
		AM6	[ RasMol ]	+environment [ RasMol ]
		AM7	[ RasMol ]	+environment [ RasMol ]
		AM8	[ RasMol ]	+environment [ RasMol ]
		AM9	[ RasMol ]	+environment [ RasMol ]
		AN1	[ RasMol ]	+environment [ RasMol ]
		AN2	[ RasMol ]	+environment [ RasMol ]
		AN3	[ RasMol ]	+environment [ RasMol ]
		AN4	[ RasMol ]	+environment [ RasMol ]
		AN5	[ RasMol ]	+environment [ RasMol ]
		AN6	[ RasMol ]	+environment [ RasMol ]
		AN7	[ RasMol ]	+environment [ RasMol ]
		AN8	[ RasMol ]	+environment [ RasMol ]
		AN9	[ RasMol ]	+environment [ RasMol ]
		AO1	[ RasMol ]	+environment [ RasMol ]
		AO2	[ RasMol ]	+environment [ RasMol ]
		AO3	[ RasMol ]	+environment [ RasMol ]
		AO4	[ RasMol ]	+environment [ RasMol ]
		AO5	[ RasMol ]	+environment [ RasMol ]
		AO6	[ RasMol ]	+environment [ RasMol ]
		AO7	[ RasMol ]	+environment [ RasMol ]
		AO8	[ RasMol ]	+environment [ RasMol ]
		AO9	[ RasMol ]	+environment [ RasMol ]
		AP1	[ RasMol ]	+environment [ RasMol ]
		AP2	[ RasMol ]	+environment [ RasMol ]
		AP3	[ RasMol ]	+environment [ RasMol ]
		AP4	[ RasMol ]	+environment [ RasMol ]
		AP5	[ RasMol ]	+environment [ RasMol ]
		AP6	[ RasMol ]	+environment [ RasMol ]
		AP7	[ RasMol ]	+environment [ RasMol ]
		AP8	[ RasMol ]	+environment [ RasMol ]
		AP9	[ RasMol ]	+environment [ RasMol ]
		AQ1	[ RasMol ]	+environment [ RasMol ]
		AQ2	[ RasMol ]	+environment [ RasMol ]
		AQ3	[ RasMol ]	+environment [ RasMol ]
		AQ4	[ RasMol ]	+environment [ RasMol ]
		AQ5	[ RasMol ]	+environment [ RasMol ]
		AQ6	[ RasMol ]	+environment [ RasMol ]
		AQ7	[ RasMol ]	+environment [ RasMol ]
		AQ8	[ RasMol ]	+environment [ RasMol ]
		AQ9	[ RasMol ]	+environment [ RasMol ]
		AR1	[ RasMol ]	+environment [ RasMol ]
		AR2	[ RasMol ]	+environment [ RasMol ]
		AR3	[ RasMol ]	+environment [ RasMol ]
		AR4	[ RasMol ]	+environment [ RasMol ]
		AR5	[ RasMol ]	+environment [ RasMol ]
		AR6	[ RasMol ]	+environment [ RasMol ]
		AR7	[ RasMol ]	+environment [ RasMol ]
		AR8	[ RasMol ]	+environment [ RasMol ]
		AR9	[ RasMol ]	+environment [ RasMol ]
		AS1	[ RasMol ]	+environment [ RasMol ]
		AS2	[ RasMol ]	+environment [ RasMol ]
		AS3	[ RasMol ]	+environment [ RasMol ]
		AS4	[ RasMol ]	+environment [ RasMol ]
		AS5	[ RasMol ]	+environment [ RasMol ]
		AS6	[ RasMol ]	+environment [ RasMol ]
		AS7	[ RasMol ]	+environment [ RasMol ]
		AS8	[ RasMol ]	+environment [ RasMol ]
		AS9	[ RasMol ]	+environment [ RasMol ]
		AT1	[ RasMol ]	+environment [ RasMol ]
		AT2	[ RasMol ]	+environment [ RasMol ]
		AT3	[ RasMol ]	+environment [ RasMol ]
		AT4	[ RasMol ]	+environment [ RasMol ]
		AT5	[ RasMol ]	+environment [ RasMol ]
		AT6	[ RasMol ]	+environment [ RasMol ]
		AT7	[ RasMol ]	+environment [ RasMol ]
		AT8	[ RasMol ]	+environment [ RasMol ]
		AT9	[ RasMol ]	+environment [ RasMol ]
		AU1	[ RasMol ]	+environment [ RasMol ]
		AU2	[ RasMol ]	+environment [ RasMol ]
		AU3	[ RasMol ]	+environment [ RasMol ]
		AU4	[ RasMol ]	+environment [ RasMol ]
		AU5	[ RasMol ]	+environment [ RasMol ]
		AU6	[ RasMol ]	+environment [ RasMol ]
		AU7	[ RasMol ]	+environment [ RasMol ]
		AU8	[ RasMol ]	+environment [ RasMol ]
		AU9	[ RasMol ]	+environment [ RasMol ]
		AV1	[ RasMol ]	+environment [ RasMol ]
		AV2	[ RasMol ]	+environment [ RasMol ]
		AV3	[ RasMol ]	+environment [ RasMol ]
		AV4	[ RasMol ]	+environment [ RasMol ]
		AV5	[ RasMol ]	+environment [ RasMol ]
		AV6	[ RasMol ]	+environment [ RasMol ]
		AV7	[ RasMol ]	+environment [ RasMol ]
		AV8	[ RasMol ]	+environment [ RasMol ]
		AV9	[ RasMol ]	+environment [ RasMol ]
		AW1	[ RasMol ]	+environment [ RasMol ]
		AW2	[ RasMol ]	+environment [ RasMol ]
		AW3	[ RasMol ]	+environment [ RasMol ]
		AW4	[ RasMol ]	+environment [ RasMol ]
		AW5	[ RasMol ]	+environment [ RasMol ]
		AW6	[ RasMol ]	+environment [ RasMol ]
		AW7	[ RasMol ]	+environment [ RasMol ]
		AW8	[ RasMol ]	+environment [ RasMol ]
		AW9	[ RasMol ]	+environment [ RasMol ]
		AX1	[ RasMol ]	+environment [ RasMol ]
		AX2	[ RasMol ]	+environment [ RasMol ]
		AX3	[ RasMol ]	+environment [ RasMol ]
		AX4	[ RasMol ]	+environment [ RasMol ]
		AX5	[ RasMol ]	+environment [ RasMol ]
		AX6	[ RasMol ]	+environment [ RasMol ]
		AX7	[ RasMol ]	+environment [ RasMol ]
		AX8	[ RasMol ]	+environment [ RasMol ]
		AX9	[ RasMol ]	+environment [ RasMol ]
		AY1	[ RasMol ]	+environment [ RasMol ]
		AY2	[ RasMol ]	+environment [ RasMol ]
		AY3	[ RasMol ]	+environment [ RasMol ]
		AY4	[ RasMol ]	+environment [ RasMol ]
		AY5	[ RasMol ]	+environment [ RasMol ]
		AY6	[ RasMol ]	+environment [ RasMol ]
		AY7	[ RasMol ]	+environment [ RasMol ]
		AY8	[ RasMol ]	+environment [ RasMol ]
		AY9	[ RasMol ]	+environment [ RasMol ]
		AZ1	[ RasMol ]	+environment [ RasMol ]
		AZ2	[ RasMol ]	+environment [ RasMol ]
		AZ3	[ RasMol ]	+environment [ RasMol ]
		AZ4	[ RasMol ]	+environment [ RasMol ]
		AZ5	[ RasMol ]	+environment [ RasMol ]
		AZ6	[ RasMol ]	+environment [ RasMol ]
		AZ7	[ RasMol ]	+environment [ RasMol ]
		AZ8	[ RasMol ]	+environment [ RasMol ]
		AZ9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]
		BC9	[ RasMol ]	+environment [ RasMol ]
		BD1	[ RasMol ]	+environment [ RasMol ]
		BD2	[ RasMol ]	+environment [ RasMol ]
		BD3	[ RasMol ]	+environment [ RasMol ]
		BD4	[ RasMol ]	+environment [ RasMol ]
		BD5	[ RasMol ]	+environment [ RasMol ]
		BD6	[ RasMol ]	+environment [ RasMol ]
		BD7	[ RasMol ]	+environment [ RasMol ]
		BD8	[ RasMol ]	+environment [ RasMol ]
		BD9	[ RasMol ]	+environment [ RasMol ]
		BE1	[ RasMol ]	+environment [ RasMol ]
		BE2	[ RasMol ]	+environment [ RasMol ]
		BE3	[ RasMol ]	+environment [ RasMol ]
		BE4	[ RasMol ]	+environment [ RasMol ]
		BE5	[ RasMol ]	+environment [ RasMol ]
		BE6	[ RasMol ]	+environment [ RasMol ]
		BE7	[ RasMol ]	+environment [ RasMol ]
		BE8	[ RasMol ]	+environment [ RasMol ]
		BE9	[ RasMol ]	+environment [ RasMol ]
		BF1	[ RasMol ]	+environment [ RasMol ]
		BF2	[ RasMol ]	+environment [ RasMol ]
		BF3	[ RasMol ]	+environment [ RasMol ]
		BF4	[ RasMol ]	+environment [ RasMol ]
		BF5	[ RasMol ]	+environment [ RasMol ]
		BF6	[ RasMol ]	+environment [ RasMol ]
		BF7	[ RasMol ]	+environment [ RasMol ]
		BF8	[ RasMol ]	+environment [ RasMol ]
		BF9	[ RasMol ]	+environment [ RasMol ]
		BG1	[ RasMol ]	+environment [ RasMol ]
		BG2	[ RasMol ]	+environment [ RasMol ]
		BG3	[ RasMol ]	+environment [ RasMol ]
		BG4	[ RasMol ]	+environment [ RasMol ]
		BG5	[ RasMol ]	+environment [ RasMol ]
		BG6	[ RasMol ]	+environment [ RasMol ]
		BG7	[ RasMol ]	+environment [ RasMol ]
		BG8	[ RasMol ]	+environment [ RasMol ]
		BG9	[ RasMol ]	+environment [ RasMol ]
		BH1	[ RasMol ]	+environment [ RasMol ]
		BH2	[ RasMol ]	+environment [ RasMol ]
		BH3	[ RasMol ]	+environment [ RasMol ]
		BH4	[ RasMol ]	+environment [ RasMol ]
		BH5	[ RasMol ]	+environment [ RasMol ]
		BH6	[ RasMol ]	+environment [ RasMol ]
		BH7	[ RasMol ]	+environment [ RasMol ]
		BH8	[ RasMol ]	+environment [ RasMol ]
		BH9	[ RasMol ]	+environment [ RasMol ]
		BI1	[ RasMol ]	+environment [ RasMol ]
		BI2	[ RasMol ]	+environment [ RasMol ]
		BI3	[ RasMol ]	+environment [ RasMol ]
		BI4	[ RasMol ]	+environment [ RasMol ]
		BI5	[ RasMol ]	+environment [ RasMol ]
		BI6	[ RasMol ]	+environment [ RasMol ]
		BI7	[ RasMol ]	+environment [ RasMol ]
		BI8	[ RasMol ]	+environment [ RasMol ]
		BI9	[ RasMol ]	+environment [ RasMol ]
		BJ1	[ RasMol ]	+environment [ RasMol ]
		BJ2	[ RasMol ]	+environment [ RasMol ]
		BJ3	[ RasMol ]	+environment [ RasMol ]
		BJ4	[ RasMol ]	+environment [ RasMol ]
		BJ5	[ RasMol ]	+environment [ RasMol ]
		BJ6	[ RasMol ]	+environment [ RasMol ]
		BJ7	[ RasMol ]	+environment [ RasMol ]
		BJ8	[ RasMol ]	+environment [ RasMol ]
		BJ9	[ RasMol ]	+environment [ RasMol ]
		BK1	[ RasMol ]	+environment [ RasMol ]
		BK2	[ RasMol ]	+environment [ RasMol ]
		BK3	[ RasMol ]	+environment [ RasMol ]
		BK4	[ RasMol ]	+environment [ RasMol ]
		BK5	[ RasMol ]	+environment [ RasMol ]
		BK6	[ RasMol ]	+environment [ RasMol ]
		BK7	[ RasMol ]	+environment [ RasMol ]
		BK8	[ RasMol ]	+environment [ RasMol ]
		BK9	[ RasMol ]	+environment [ RasMol ]
		BL1	[ RasMol ]	+environment [ RasMol ]
		BL2	[ RasMol ]	+environment [ RasMol ]
		BL3	[ RasMol ]	+environment [ RasMol ]
		BL4	[ RasMol ]	+environment [ RasMol ]
		BL5	[ RasMol ]	+environment [ RasMol ]
		BL6	[ RasMol ]	+environment [ RasMol ]
		BL7	[ RasMol ]	+environment [ RasMol ]
		BL8	[ RasMol ]	+environment [ RasMol ]
		BL9	[ RasMol ]	+environment [ RasMol ]
		BM1	[ RasMol ]	+environment [ RasMol ]
		BM2	[ RasMol ]	+environment [ RasMol ]
		BM3	[ RasMol ]	+environment [ RasMol ]
		BM4	[ RasMol ]	+environment [ RasMol ]
		BM5	[ RasMol ]	+environment [ RasMol ]
		BM6	[ RasMol ]	+environment [ RasMol ]
		BM7	[ RasMol ]	+environment [ RasMol ]
		BM8	[ RasMol ]	+environment [ RasMol ]
		BM9	[ RasMol ]	+environment [ RasMol ]
		BN1	[ RasMol ]	+environment [ RasMol ]
		BN2	[ RasMol ]	+environment [ RasMol ]
		BN3	[ RasMol ]	+environment [ RasMol ]
		BN4	[ RasMol ]	+environment [ RasMol ]
		BN5	[ RasMol ]	+environment [ RasMol ]
		BN6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala U:53 - Pro U:54	[ RasMol ]
		Ala u:53 - Pro u:54	[ RasMol ]
		Thr V:63 - Pro V:64	[ RasMol ]
		Thr v:63 - Pro v:64	[ RasMol ]
		Tyr U:42 - Pro U:43	[ RasMol ]
		Tyr u:42 - Pro u:43	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (21, 355)

Sites (321, 321)

SS Bonds (2, 2)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (30, 184)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File