3KZI - JenaLib

Asymmetric Unit (87, 87)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	HIS A:215 , HIS A:272 , HIS D:214 , HIS D:268 , BCT D:353	BINDING SITE FOR RESIDUE FE2 A 361
02	AC2	SOFTWARE	PHE A:119 , TYR A:147 , PRO A:150 , SER A:153 , ALA A:154 , VAL A:157 , PHE A:182 , MET A:183 , PHE A:186 , GLN A:187 , LEU A:193 , HIS A:198 , VAL A:205 , THR A:286 , ALA A:287 , ILE A:290 , CLA A:363 , CLA A:364 , PHO A:365 , LEU D:182 , CLA D:354 , PHE T:17	BINDING SITE FOR RESIDUE CLA A 362
03	AC3	SOFTWARE	THR A:45 , VAL A:157 , PHE A:158 , MET A:172 , ILE A:176 , THR A:179 , MET A:183 , CLA A:362 , PHO A:365 , MET D:198 , VAL D:201 , ALA D:202 , CLA D:354 , PL9 D:357 , LMG D:360 , LEU L:30 , PHE T:10 , ILE T:14	BINDING SITE FOR RESIDUE CLA A 363
04	AC4	SOFTWARE	LEU A:41 , THR A:45 , PHE A:48 , PHE A:119 , TYR A:126 , GLN A:130 , TYR A:147 , PRO A:150 , LEU A:174 , CLA A:362 , CLA A:363 , LEU D:205 , ALA D:208 , LEU D:209 , ALA D:212 , ILE D:213 , TRP D:253 , PHE D:257 , LMG D:360	BINDING SITE FOR RESIDUE PHO A 365
05	AC5	SOFTWARE	VAL A:35 , ILE A:36 , PRO A:39 , THR A:40 , PHE A:93 , ILE A:96 , TRP A:97 , LEU A:114 , PHE A:117 , HIS A:118 , LEU A:121 , BCR A:369 , DGD C:474 , CLA C:481 , VAL I:8 , TYR I:9 , VAL I:12 , PHE I:15	BINDING SITE FOR RESIDUE CLA A 366
06	AC6	SOFTWARE	MET A:214 , HIS A:215 , LEU A:218 , VAL A:219 , TYR A:246 , ALA A:251 , LEU A:271	BINDING SITE FOR RESIDUE MES A 367
07	AC7	SOFTWARE	ASP A:170 , GLU A:189 , HIS A:332 , GLU A:333 , ASP A:342 , ALA A:344 , GLU C:354	BINDING SITE FOR RESIDUE OEC A 368
08	AC8	SOFTWARE	VAL A:35 , ILE A:38 , PRO A:39 , LEU A:42 , ALA A:43 , ILE A:46 , ALA A:51 , ALA A:55 , TRP A:105 , LEU A:106 , CLA A:366	BINDING SITE FOR RESIDUE BCR A 369
09	AC9	SOFTWARE	PHE A:93 , PRO A:95 , TRP A:97 , GLU A:98 , LEU A:121 , PHE A:155 , CLA A:366 , LEU C:213 , LEU C:214 , LYS C:215 , SER C:216 , PRO C:217 , TRP C:223 , MET C:281 , PHE C:284 , CLA C:481 , DGD C:491 , LYS I:5	BINDING SITE FOR RESIDUE DGD C 474
10	BC1	SOFTWARE	ARG A:140 , TRP A:142 , PHE A:273 , TRP C:36 , PHE C:436 , TRP C:443 , ARG C:447 , SQD C:475 , CLA C:480 , CLA C:484 , ALA D:229 , SER D:230 , THR D:231 , PHE D:232	BINDING SITE FOR RESIDUE LHG A 371
11	BC2	SOFTWARE	PHE A:273 , LHG A:371 , ALA C:34 , TRP C:36 , LHG C:476 , CLA C:484 , PHE D:232 , ARG D:233 , LMG D:359 , BCR J:115	BINDING SITE FOR RESIDUE SQD C 475
12	BC3	SOFTWARE	SER A:232 , ASN A:234 , TYR A:235 , PRO B:4 , TRP B:5 , TYR B:6 , CLA B:521 , TRP D:266 , PHE D:273 , PL9 D:357 , LMG D:360 , GLU L:11 , ASN L:13 , SER L:16 , GLY L:20 , LEU L:23 , ILE L:24 , VAL L:26 , PRO M:18 , LEU M:22	BINDING SITE FOR RESIDUE LMG A 373
13	BC4	SOFTWARE	SQD C:475 , DGD C:492 , BCR J:115	BINDING SITE FOR RESIDUE LHG C 476
14	BC5	SOFTWARE	ILE A:46 , ILE A:50 , LMT A:376 , LMG I:220 , LMT I:274 , LMT O:274	BINDING SITE FOR RESIDUE DGD A 375
15	BC6	SOFTWARE	ALA A:54 , ASP A:103 , DGD A:375	BINDING SITE FOR RESIDUE LMT A 376
16	BC7	SOFTWARE	TRP B:185 , PRO B:187 , PHE B:190 , ALA B:204 , CLA B:512 , BCR X:107	BINDING SITE FOR RESIDUE CLA B 511
17	BC8	SOFTWARE	GLY B:189 , PHE B:190 , PRO B:192 , HIS B:201 , ALA B:204 , VAL B:208 , PHE B:247 , PHE B:250 , CLA B:511 , CLA B:513 , DGD B:528 , PHE H:38 , PHE H:41 , LEU H:42 , ILE H:45 , TYR H:49 , BCR X:107	BINDING SITE FOR RESIDUE CLA B 512
18	BC9	SOFTWARE	ARG B:68 , LEU B:69 , LEU B:149 , CYS B:150 , PHE B:153 , MET B:166 , HIS B:201 , HIS B:202 , PHE B:247 , ALA B:248 , VAL B:251 , VAL B:252 , THR B:255 , THR B:262 , CLA B:512 , CLA B:514 , CLA B:515 , CLA B:516 , CLA B:519 , CLA B:520 , PHE H:38	BINDING SITE FOR RESIDUE CLA B 513
19	CC1	SOFTWARE	TRP B:33 , PHE B:61 , PHE B:65 , ARG B:68 , LEU B:148 , LEU B:149 , VAL B:245 , ALA B:248 , ALA B:249 , VAL B:252 , PHE B:451 , HIS B:455 , PHE B:458 , ALA B:459 , PHE B:462 , CLA B:513 , CLA B:515 , CLA B:517 , CLA B:520 , CLA B:521 , CLA B:522 , CLA B:523 , CLA B:525	BINDING SITE FOR RESIDUE CLA B 514
20	CC2	SOFTWARE	THR B:27 , VAL B:30 , ALA B:31 , TRP B:33 , ALA B:34 , VAL B:62 , PHE B:65 , MET B:66 , ARG B:68 , LEU B:69 , HIS B:100 , LEU B:103 , GLY B:147 , ALA B:205 , CLA B:513 , CLA B:514 , CLA B:516 , CLA B:519 , CLA B:520 , CLA B:522 , BCR B:530	BINDING SITE FOR RESIDUE CLA B 515
21	CC3	SOFTWARE	TRP B:91 , VAL B:96 , ALA B:99 , HIS B:100 , LEU B:103 , LEU B:106 , LEU B:149 , GLY B:152 , PHE B:153 , PHE B:156 , HIS B:157 , PHE B:162 , PRO B:164 , CLA B:513 , CLA B:515 , CLA B:526	BINDING SITE FOR RESIDUE CLA B 516
22	CC4	SOFTWARE	TRP B:33 , MET B:37 , TYR B:40 , GLN B:58 , GLY B:59 , PHE B:61 , PHE B:325 , ARG B:326 , THR B:327 , GLY B:328 , PRO B:329 , TRP B:450 , PHE B:451 , ALA B:454 , CLA B:514 , CLA B:523 , BCR B:529 , LMG B:531 , DGD B:533 , MET D:199 , MET D:281 , PHE M:14	BINDING SITE FOR RESIDUE CLA B 517
23	CC5	SOFTWARE	THR B:236 , SER B:239 , SER B:240 , ALA B:243 , PHE B:246 , PHE B:247 , HIS B:466 , CLA B:519 , CLA B:520 , PHE D:120 , ILE D:123 , MET D:126 , LEU D:127 , PHE D:130 , CLA D:356 , SQD D:361 , LEU H:43	BINDING SITE FOR RESIDUE CLA B 518
24	CC6	SOFTWARE	PHE B:139 , VAL B:208 , ALA B:212 , PHE B:215 , HIS B:216 , ARG B:220 , PRO B:221 , PRO B:222 , LEU B:225 , LEU B:229 , CLA B:513 , CLA B:515 , CLA B:518 , CLA B:520 , THR H:27 , THR H:28 , MET H:31 , PHE H:34 , LEU H:46 , BCR X:107	BINDING SITE FOR RESIDUE CLA B 519
25	CC7	SOFTWARE	PHE B:139 , HIS B:142 , LEU B:143 , MET B:231 , ILE B:234 , VAL B:237 , SER B:240 , CLA B:513 , CLA B:514 , CLA B:515 , CLA B:518 , CLA B:519 , CLA B:522 , CLA B:525	BINDING SITE FOR RESIDUE CLA B 520
26	CC8	SOFTWARE	LMG A:373 , TRP B:5 , TYR B:6 , ARG B:7 , HIS B:9 , ILE B:242 , LEU B:461 , PHE B:462 , PHE B:464 , GLY B:465 , TRP B:468 , HIS B:469 , ARG B:472 , PHE B:479 , CLA B:514 , CLA B:522 , CLA B:523 , CLA B:524 , LMG B:531 , PHE M:21	BINDING SITE FOR RESIDUE CLA B 521
27	CC9	SOFTWARE	HIS B:9 , HIS B:23 , HIS B:26 , THR B:27 , ILE B:234 , GLU B:235 , VAL B:237 , LEU B:238 , SER B:241 , ILE B:242 , CLA B:514 , CLA B:515 , CLA B:520 , CLA B:521 , CLA B:523 , CLA B:524 , CLA B:525	BINDING SITE FOR RESIDUE CLA B 522
28	DC1	SOFTWARE	HIS B:9 , HIS B:26 , VAL B:30 , TRP B:33 , PHE B:462 , CLA B:514 , CLA B:517 , CLA B:521 , CLA B:522 , CLA B:524 , BCR B:527 , LMG B:531	BINDING SITE FOR RESIDUE CLA B 523
29	DC2	SOFTWARE	VAL B:8 , HIS B:9 , ALA B:22 , TRP B:115 , CLA B:521 , CLA B:522 , CLA B:523 , BCR B:527 , DGD B:533 , VAL L:10 , PHE M:21 , LEU M:25	BINDING SITE FOR RESIDUE CLA B 524
30	DC3	SOFTWARE	HIS B:23 , LEU B:24 , MET B:138 , HIS B:142 , LEU B:145 , CLA B:514 , CLA B:520 , CLA B:522 , CLA B:526 , BCR B:530 , LEU H:14	BINDING SITE FOR RESIDUE CLA B 525
31	DC4	SOFTWARE	LEU B:24 , ALA B:110 , TRP B:113 , HIS B:114 , CLA B:516 , CLA B:525 , BCR B:530 , THR H:5 , LEU H:7 , GLY H:8	BINDING SITE FOR RESIDUE CLA B 526
32	DC5	SOFTWARE	MET B:25 , LEU B:29 , ALA B:111 , TRP B:115 , CLA B:523 , CLA B:524 , BCR B:529 , DGD B:533 , LEU M:13	BINDING SITE FOR RESIDUE BCR B 527
33	DC6	SOFTWARE	LEU B:29 , TRP B:33 , GLY B:105 , CLA B:517 , BCR B:527 , DGD B:533	BINDING SITE FOR RESIDUE BCR B 529
34	DC7	SOFTWARE	CLA B:515 , CLA B:525 , CLA B:526 , LMT B:535	BINDING SITE FOR RESIDUE BCR B 530
35	DC8	SOFTWARE	ALA A:233 , TYR B:6 , ARG B:7 , PHE B:464 , TRP B:468 , PHE B:479 , CLA B:517 , CLA B:521 , CLA B:523 , DGD B:533 , ARG D:139 , TYR D:141 , PHE D:269 , LEU D:272 , VAL D:276 , PHE M:14 , PRO M:18	BINDING SITE FOR RESIDUE LMG B 531
36	DC9	SOFTWARE	THR B:327 , LYS B:332 , LEU B:461 , CLA B:517 , CLA B:524 , BCR B:527 , BCR B:529 , LMG B:531 , ILE D:284 , PHE L:35 , ASN M:4 , LEU M:6 , ALA M:10 , LEU M:13 , PHE M:14 , VAL M:17	BINDING SITE FOR RESIDUE DGD B 533
37	EC1	SOFTWARE	TRP B:91 , LEU B:149 , BCR B:530	BINDING SITE FOR RESIDUE LMT B 535
38	EC2	SOFTWARE	LYS B:227 , ASP D:19 , ASP D:20 , LYS D:23 , SQD D:361 , MET H:35	BINDING SITE FOR RESIDUE LMT D 536
39	EC3	SOFTWARE	LEU C:95 , LEU C:168 , GLY C:171 , ALA C:172 , TRP C:223 , ILE C:224 , HIS C:237 , ILE C:240 , PHE C:289 , VAL C:296 , TYR C:297 , CLA C:478 , CLA C:479 , CLA C:482 , CLA C:483 , BCR C:490	BINDING SITE FOR RESIDUE CLA C 477
40	EC4	SOFTWARE	TRP C:63 , HIS C:91 , LEU C:174 , LEU C:175 , LYS C:178 , PHE C:182 , LEU C:279 , MET C:282 , GLY C:283 , ALA C:286 , VAL C:290 , TYR C:297 , HIS C:430 , LEU C:433 , ALA C:434 , PHE C:437 , CLA C:477 , CLA C:479 , CLA C:480 , CLA K:483	BINDING SITE FOR RESIDUE CLA C 478
41	EC5	SOFTWARE	ILE C:60 , VAL C:61 , TRP C:63 , ALA C:64 , THR C:68 , LEU C:88 , HIS C:91 , LEU C:95 , VAL C:114 , HIS C:118 , CLA C:477 , CLA C:478 , LMG C:494 , CLA K:483	BINDING SITE FOR RESIDUE CLA C 479
42	EC6	SOFTWARE	VAL A:281 , LHG A:371 , TRP C:63 , MET C:67 , PHE C:70 , GLN C:84 , GLY C:85 , LEU C:404 , TRP C:425 , LEU C:426 , SER C:429 , CLA C:478 , CLA C:484 , DGD C:492 , DGD C:493 , LMG J:492 , PRO K:26 , CLA K:483	BINDING SITE FOR RESIDUE CLA C 480
43	EC7	SOFTWARE	PHE A:33 , MET A:127 , GLY A:128 , TRP A:131 , CLA A:366 , PHE C:264 , ILE C:265 , TYR C:274 , GLY C:277 , MET C:281 , HIS C:441 , LEU C:442 , ALA C:445 , ARG C:449 , DGD C:474 , CLA C:483 , BCR C:490 , PHE I:23	BINDING SITE FOR RESIDUE CLA C 481
44	EC8	SOFTWARE	LEU C:161 , LEU C:165 , ILE C:243 , CYS C:244 , TRP C:250 , HIS C:251 , THR C:255 , PRO C:256 , PHE C:257 , TRP C:259 , ALA C:260 , PHE C:264 , CLA C:477 , CLA C:483 , BCR C:490	BINDING SITE FOR RESIDUE CLA C 482
45	EC9	SOFTWARE	MET C:157 , LEU C:161 , HIS C:164 , LEU C:165 , LEU C:168 , ILE C:240 , PHE C:264 , TRP C:266 , TYR C:271 , TYR C:274 , SER C:275 , CLA C:477 , CLA C:481 , CLA C:482 , CLA C:485 , BCR C:490	BINDING SITE FOR RESIDUE CLA C 483
46	FC1	SOFTWARE	LHG A:371 , TRP C:36 , ALA C:37 , GLY C:38 , ASN C:39 , ALA C:40 , GLU C:269 , LEU C:276 , PHE C:436 , PHE C:437 , GLY C:440 , TRP C:443 , HIS C:444 , ARG C:447 , SQD C:475 , CLA C:480 , CLA C:485 , CLA C:486 , CLA K:483	BINDING SITE FOR RESIDUE CLA C 484
47	FC2	SOFTWARE	ASN C:39 , ILE C:43 , LEU C:49 , ALA C:52 , HIS C:53 , HIS C:56 , TRP C:151 , HIS C:164 , GLY C:268 , TYR C:271 , LEU C:272 , SER C:275 , LEU C:276 , LEU C:279 , CLA C:483 , CLA C:484 , CLA C:487 , CLA K:483	BINDING SITE FOR RESIDUE CLA C 485
48	FC3	SOFTWARE	HIS C:56 , LEU C:59 , ILE C:60 , TRP C:63 , LEU C:279 , PHE C:436 , PHE C:437 , CLA C:478 , CLA C:479 , CLA C:480 , CLA C:484 , CLA C:485 , CLA C:486 , PRO K:29 , VAL K:30 , LEU K:33	BINDING SITE FOR RESIDUE CLA K 483
49	FC4	SOFTWARE	GLN C:28 , TRP C:35 , GLY C:38 , ASN C:39 , ARG C:41 , LEU C:42 , LEU C:45 , LYS C:48 , ALA C:52 , ALA C:123 , PHE C:127 , VAL C:130 , ALA C:133 , ILE C:134 , CLA C:484 , BCR C:489 , PHE K:32 , LEU K:33 , PHE K:37 , TRP K:39 , GLN K:40 , CLA K:483 , MET Z:19 , VAL Z:20 , PRO Z:24 , ILE y:35 , LEU y:39 , ASN y:45	BINDING SITE FOR RESIDUE CLA C 486
50	FC5	SOFTWARE	HIS C:53 , VAL C:54 , ALA C:57 , LEU C:125 , ILE C:160 , PHE C:163 , HIS C:164 , VAL C:167 , ILE C:170 , GLY C:171 , LEU C:174 , CLA C:485 , CLA C:488 , BCR Z:116	BINDING SITE FOR RESIDUE CLA C 487
51	FC6	SOFTWARE	VAL C:54 , VAL C:124 , LEU C:125 , GLY C:128 , TYR C:131 , HIS C:132 , PHE C:147 , CLA C:487 , BCR Z:116	BINDING SITE FOR RESIDUE CLA C 488
52	FC7	SOFTWARE	ALA C:55 , GLY C:58 , LEU C:59 , VAL C:116 , LEU C:119 , SER C:122 , ALA C:123 , CLA C:486 , BCR J:112 , TYR K:15 , PHE K:18 , LEU K:21 , LEU Z:9 , VAL Z:13 , VAL Z:20	BINDING SITE FOR RESIDUE BCR C 489
53	FC8	SOFTWARE	ILE C:209 , PHE C:210 , TYR C:212 , LEU C:213 , VAL C:227 , ASP C:232 , VAL C:233 , HIS C:237 , ILE C:240 , PHE C:264 , CLA C:477 , CLA C:481 , CLA C:482 , CLA C:483 , PHE I:23	BINDING SITE FOR RESIDUE BCR C 490
54	FC9	SOFTWARE	PHE A:155 , ILE A:160 , PRO C:217 , PHE C:218 , GLY C:219 , GLY C:220 , TRP C:223 , VAL C:225 , PHE C:284 , CYS C:288 , PHE C:292 , ASN C:293 , ASN C:294 , THR C:295 , ASP C:360 , ARG C:362 , LEU C:438 , DGD C:474	BINDING SITE FOR RESIDUE DGD C 491
55	GC1	SOFTWARE	PHE A:197 , THR A:292 , GLU C:83 , GLN C:84 , GLY C:85 , SER C:406 , ASN C:418 , PHE C:419 , VAL C:420 , TRP C:425 , VAL C:432 , LHG C:476 , CLA C:480 , DGD C:493 , PHE J:29 , TYR J:33 , BCR J:115 , LMG J:492	BINDING SITE FOR RESIDUE DGD C 492
56	GC2	SOFTWARE	LEU A:200 , ALA A:203 , TRP A:278 , VAL A:281 , PHE A:300 , CLA A:364 , LEU C:404 , ASN C:405 , SER C:406 , VAL C:407 , ASN C:415 , SER C:416 , VAL C:417 , ASN C:418 , CLA C:480 , DGD C:492 , LMG D:359 , PHE J:29 , ALA J:32 , TYR J:33 , GLY J:37 , SER J:38 , SER J:39 , LEU J:40	BINDING SITE FOR RESIDUE DGD C 493
57	GC3	SOFTWARE	HIS C:74 , CLA C:480 , DGD C:492 , ILE J:22 , BCR J:115 , VAL K:30 , ILE y:25	BINDING SITE FOR RESIDUE LMG J 492
58	GC4	SOFTWARE	PHE C:109 , PRO C:110 , VAL C:113 , VAL C:114 , VAL C:117 , CLA C:479 , BCR Z:116	BINDING SITE FOR RESIDUE LMG C 494
59	GC5	SOFTWARE	HIS A:215 , TYR A:246 , HIS A:272 , FE2 A:361 , HIS D:214 , TYR D:244 , LYS D:264 , HIS D:268	BINDING SITE FOR RESIDUE BCT D 353
60	GC6	SOFTWARE	PHE A:206 , CLA A:362 , CLA A:363 , CLA A:364 , TRP D:48 , LEU D:122 , PRO D:149 , VAL D:152 , SER D:155 , VAL D:156 , PHE D:181 , LEU D:182 , PHE D:185 , GLN D:186 , TRP D:191 , THR D:192 , HIS D:197 , VAL D:201 , VAL D:204 , LEU D:279 , SER D:282 , ALA D:283 , VAL D:286 , PHO D:355 , LMG D:359	BINDING SITE FOR RESIDUE CLA D 354
61	GC7	SOFTWARE	GLN A:199 , VAL A:202 , ALA A:203 , CLA A:362 , DGD C:493 , PHE D:153 , PHE D:157 , VAL D:175 , ILE D:178 , PHE D:181 , LEU D:182 , CLA D:354 , PHO D:355 , LMG D:359	BINDING SITE FOR RESIDUE CLA A 364
62	GC8	SOFTWARE	LEU A:210 , MET A:214 , ILE A:259 , CLA A:364 , LEU D:37 , ALA D:41 , ALA D:44 , TRP D:48 , GLY D:118 , GLY D:121 , LEU D:122 , PHE D:125 , ASN D:142 , PHE D:146 , ALA D:148 , PRO D:149 , GLY D:174 , PRO D:275 , LEU D:279 , CLA D:354	BINDING SITE FOR RESIDUE PHO D 355
63	GC9	SOFTWARE	CLA B:518 , ILE D:35 , PRO D:39 , LEU D:43 , LEU D:89 , LEU D:90 , LEU D:91 , LEU D:92 , TRP D:93 , TRP D:104 , THR D:112 , PHE D:113 , HIS D:117 , VAL H:40 , LEU X:23 , GLY X:26	BINDING SITE FOR RESIDUE CLA D 356
64	HC1	SOFTWARE	ILE A:53 , CLA A:363 , LMG A:373 , ALA D:202 , LEU D:210 , ILE D:213 , HIS D:214 , THR D:217 , MET D:246 , TRP D:253 , ALA D:260 , PHE D:261 , LEU D:267 , VAL D:274 , LMG D:360 , VAL L:26 , LEU L:29 , PHE T:10	BINDING SITE FOR RESIDUE PL9 D 357
65	HC2	SOFTWARE	TYR D:42 , GLY D:46 , GLY D:47 , LEU D:49 , THR D:50 , PHE D:113 , LMG D:359 , PRO F:29 , PHE F:33 , LEU F:34 , VAL J:21 , VAL J:25	BINDING SITE FOR RESIDUE BCR D 358
66	HC3	SOFTWARE	CLA A:364 , SQD C:475 , DGD C:493 , TYR D:67 , CYS D:71 , CLA D:354 , BCR D:358 , LEU F:26 , ILE F:37 , MET F:40 , GLN F:41 , PHE J:28 , GLY J:31 , ALA J:32 , GLY J:37	BINDING SITE FOR RESIDUE LMG D 359
67	HC4	SOFTWARE	CLA A:363 , PHO A:365 , LMG A:373 , ILE D:259 , ALA D:260 , PHE D:261 , SER D:262 , ASN D:263 , TRP D:266 , PL9 D:357 , THR L:15 , LEU L:19 , LEU L:22 , PHE T:10 , ILE T:13 , PHE T:17 , ALA T:20 , ILE T:21	BINDING SITE FOR RESIDUE LMG D 360
68	HC5	SOFTWARE	LYS B:227 , ARG B:230 , CLA B:518 , LYS D:23 , TRP D:32 , ARG D:134 , LEU D:135 , LMT D:536 , PHE X:34	BINDING SITE FOR RESIDUE SQD D 361
69	HC6	SOFTWARE	PHE D:101 , ARG D:103 , SQD F:224	BINDING SITE FOR RESIDUE DGD D 362
70	HC7	SOFTWARE	GLU B:350 , GLN D:98 , GLY D:99 , ILE X:21	BINDING SITE FOR RESIDUE LMT D 363
71	HC8	SOFTWARE	ARG E:8 , PHE E:10 , ILE E:13 , ARG E:18 , TYR E:19 , HIS E:23 , THR E:26 , LEU E:30 , PHE F:16 , ARG F:19 , TRP F:20 , HIS F:24 , ALA F:27 , ILE F:31	BINDING SITE FOR RESIDUE HEM F 85
72	HC9	SOFTWARE	TRP D:21 , ARG D:24 , DGD D:362 , PRO F:14 , PHE F:16 , THR F:17 , VAL F:18 , TRP F:20 , ILE X:40	BINDING SITE FOR RESIDUE SQD F 224
73	IC1	SOFTWARE	ARG F:45 , GLU V:49	BINDING SITE FOR RESIDUE CA F 225
74	IC2	SOFTWARE	CLA B:511 , CLA B:512 , CLA B:519 , MET H:35 , PHE H:38 , PHE H:41 , THR X:11 , ILE X:12 , LEU X:16 , PHE X:20	BINDING SITE FOR RESIDUE BCR X 107
75	IC3	SOFTWARE	TYR B:193 , PHE B:250 , GLY B:254 , TYR B:258 , TYR B:273 , SER B:277 , PHE B:463 , CLA B:512 , GLY D:86 , HIS D:87 , PHE D:120 , ILE D:159 , LEU D:162 , SER D:165 , LEU H:46 , TYR H:49 , VAL H:60 , SER H:61	BINDING SITE FOR RESIDUE DGD B 528
76	IC4	SOFTWARE	DGD A:375 , LMT I:274	BINDING SITE FOR RESIDUE LMG I 220
77	IC5	SOFTWARE	SQD C:475 , LHG C:476 , DGD C:492 , VAL J:21 , ILE J:22 , PHE J:29 , TYR J:30 , TYR J:33 , LMG J:492	BINDING SITE FOR RESIDUE BCR J 115
78	IC6	SOFTWARE	ASP K:19 , ASP K:23	BINDING SITE FOR RESIDUE CA K 56
79	IC7	SOFTWARE	BCR C:489 , ALA J:14 , THR J:15 , GLY J:18 , MET J:19 , LEU K:21 , LEU K:31 , PHE K:32 , PHE K:37 , VAL K:38 , SER Z:16 , PHE Z:17 , ILE y:28 , GLY y:29 , GLY y:32	BINDING SITE FOR RESIDUE BCR J 112
80	IC8	SOFTWARE	SQD L:213 , ILE M:23 , GLU M:30 , SER M:31	BINDING SITE FOR RESIDUE LMG M 217
81	IC9	SOFTWARE	MET M:1 , MET T:1 , PHE T:8	BINDING SITE FOR RESIDUE LMT T 226
82	JC1	SOFTWARE	GLU O:140 , HIS O:257	BINDING SITE FOR RESIDUE CA O 273
83	JC2	SOFTWARE	ALA A:100 , DGD A:375 , MET I:1 , LEU I:4 , LMG I:220 , LYS O:95	BINDING SITE FOR RESIDUE LMT I 274
84	JC3	SOFTWARE	ARG L:14 , LEU L:21 , LMG M:217 , PHE T:19	BINDING SITE FOR RESIDUE SQD L 213
85	JC4	SOFTWARE	DGD A:375	BINDING SITE FOR RESIDUE LMT O 274
86	JC5	SOFTWARE	ALA C:393 , ALA V:62 , CYS V:63 , CYS V:66 , HIS V:67 , THR V:74 , ASN V:75 , LEU V:78 , LEU V:80 , LEU V:85 , TYR V:101 , MET V:102 , TYR V:108 , HIS V:118	BINDING SITE FOR RESIDUE HEM V 164
87	JC6	SOFTWARE	VAL C:116 , SER C:121 , LEU C:125 , CLA C:487 , CLA C:488 , LMG C:494 , TYR K:15 , VAL Z:51 , VAL Z:54 , GLY Z:55 , ASN Z:58	BINDING SITE FOR RESIDUE BCR Z 116

SS Bonds (1, 1)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 5)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:335
 aligned with PSBA1_THEEB | P0A444 from UniProtKB/Swiss-Prot  Length:360

    Alignment length:335
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     
          PSBA1_THEEB    10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA 344
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------Photo_RC-3kziA01 A:28-330                                                                                                                                                                                                                                                                                      -------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhh..............hhhhh......ee............hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee.................hhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kzi A  10 SANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA 344
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339

Chain B from PDB  Type:PROTEIN  Length:485
 aligned with PSBB_THEEB | Q8DIQ1 from UniProtKB/Swiss-Prot  Length:510

    Alignment length:485
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481     
           PSBB_THEEB     2 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPEL 486
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhh...hhhhhhh.......................hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh.........hhhhhhhhhhhhhhhhhhhhhhhh........eee........eee......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..........hhhhh..eeeee..eeeee.....eeee............eee.....eeee...hhhhh..hhhhhh.eeeee.......ee.hhhhhhhhhhhhh....eeee............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kzi B   2 GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPEL 486
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481

Chain C from PDB  Type:PROTEIN  Length:448
 aligned with PSBC_THEEB | Q8DIF8 from UniProtKB/Swiss-Prot  Length:461

    Alignment length:448
                                    23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453        
           PSBC_THEEB    14 RDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD 461
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3kziC02 C:304-399 photosystem ii from thermosynechococcus elongatus                             -------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhh..hhhhhhhh....hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee.......eee.......hhhhhhhhhhh......hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhh..hhhhh.........eee.....eee.hhhhhhh......hhhhh.....hhhhhhhh.hhhhhhhhhhhhh....ee.................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kzi C  26 RDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD 473
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465

Chain D from PDB  Type:PROTEIN  Length:340
 aligned with PSBD_THEEB | Q8CM25 from UniProtKB/Swiss-Prot  Length:352

    Alignment length:340
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352
           PSBD_THEEB    13 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 352
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------Photo_RC-3kziD01 D:28-327                                                                                                                                                                                                                                                                                   ------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhh...hhhhh......ee.....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhh..eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........................hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------REACTION_CENTER            ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kzi D  13 GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL 352
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352

Chain E from PDB  Type:PROTEIN  Length:77
 aligned with PSBE_THEEB | Q8DIP0 from UniProtKB/Swiss-Prot  Length:84

    Alignment length:77
                                    17        27        37        47        57        67        77       
           PSBE_THEEB     8 RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK  84
               SCOP domains ----------------------------------------------------------------------------- SCOP domains
               CATH domains 3kziE00 E:8-84 Photosystem q(b) protein helix                                 CATH domains
               Pfam domains Cytochrom_B559-3kziE01     -------Cytochrom_B559a-3kziE02 E:42-81         --- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......................hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------CYTOCHROME_B559-------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------- Transcript
                 3kzi E   8 RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK  84
                                    17        27        37        47        57        67        77

Chain F from PDB  Type:PROTEIN  Length:38
 aligned with PSBF_THEEB | Q8DIN9 from UniProtKB/Swiss-Prot  Length:45

    Alignment length:38
                                    17        27        37        
           PSBF_THEEB     8 QEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR  45
               SCOP domains -------------------------------------- SCOP domains
               CATH domains -------------------------------------- CATH domains
               Pfam domains Cytochrom_B559-3kziF01      ---------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------- SAPs(SNPs)
                PROSITE (2) -------CYTOCHROME_B559---------------- PROSITE (2)
                 Transcript -------------------------------------- Transcript
                 3kzi F   8 QEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR  45
                                    17        27        37

Chain H from PDB  Type:PROTEIN  Length:65
 aligned with PSBH_THEEB | Q8DJ43 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:65
                                    11        21        31        41        51        61     
           PSBH_THEEB     2 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG  66
               SCOP domains ----------------------------------------------------------------- SCOP domains
               CATH domains 3kziH01 H:2-52                                     -------------- CATH domains
               Pfam domains --PsbH-3kziH01 H:4-55                                 ----------- Pfam domains
         Sec.struct. author ...hhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------- Transcript
                 3kzi H   2 ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG  66
                                    11        21        31        41        51        61

Chain I from PDB  Type:PROTEIN  Length:35
 aligned with PSBI_THEEB | Q8DJZ6 from UniProtKB/Swiss-Prot  Length:38

    Alignment length:35
                                    10        20        30     
           PSBI_THEEB     1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK  35
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains PsbI-3kziI01 I:1-35                 Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                 3kzi I   1 METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRK  35
                                    10        20        30

Chain J from PDB  Type:PROTEIN  Length:34
 aligned with PSBJ_THEEB | P59087 from UniProtKB/Swiss-Prot  Length:40

    Alignment length:34
                                    16        26        36    
           PSBJ_THEEB     7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL  40
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains PsbJ-3kziJ01 J:7-40                Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                 3kzi J   7 RIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL  40
                                    16        26        36

Chain K from PDB  Type:PROTEIN  Length:37
 aligned with PSBK_THEEB | Q9F1K9 from UniProtKB/Swiss-Prot  Length:46

    Alignment length:37
                                    19        29        39       
           PSBK_THEEB    10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR  46
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains PsbK-3kziK01 K:10-46                  Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                 3kzi K  10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR  46
                                    19        29        39

Chain L from PDB  Type:PROTEIN  Length:37
 aligned with PSBL_THEEB | Q8DIN8 from UniProtKB/Swiss-Prot  Length:37

    Alignment length:37
                                    10        20        30       
           PSBL_THEEB     1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN  37
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains PsbL-3kziL01 L:1-37                   Pfam domains
         Sec.struct. author ............hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                 3kzi L   1 MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN  37
                                    10        20        30

Chain M from PDB  Type:PROTEIN  Length:34
 aligned with PSBM_THEEB | Q8DHA7 from UniProtKB/Swiss-Prot  Length:36

    Alignment length:34
                                    10        20        30    
           PSBM_THEEB     1 MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK  34
               SCOP domains ---------------------------------- SCOP domains
               CATH domains ---------------------------------- CATH domains
               Pfam domains PsbM-3kziM01 M:1-31            --- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ---------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------- PROSITE
                 Transcript ---------------------------------- Transcript
                 3kzi M   1 MEVNQLGLIATALFVLVPSVFLIILYVQTESQQK  34
                                    10        20        30

Chain O from PDB  Type:PROTEIN  Length:243
 aligned with PSBO_THEEB | P0A431 from UniProtKB/Swiss-Prot  Length:272

    Alignment length:243
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269   
           PSBO_THEEB    30 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA 272
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------3kziO01 O:50-178,O:215-272 Photosystem II, cytochrome c-550 precursor                                                            3kziO02 O:179-214                   3kziO01 O:50-178,O:215-272                                 CATH domains
               Pfam domains MSP-3kziO01 O:30-270                                                                                                                                                                                                                             -- Pfam domains
         Sec.struct. author ..hhhhh...hhhhh...........ee.......eeeeeeeeeeeeeee...........eee.ee.......eeeeeee.........eeeeeeee.eeeeeee.....eeeeeee.eeeeee......ee.....eeeeeeee................................hhhhhh....eeeeeeeeeeee......eeeeeeeeeee...........eeeeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kzi O  30 TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA 272
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269

Chain T from PDB  Type:PROTEIN  Length:30
 aligned with PSBT_THEEB | Q8DIQ0 from UniProtKB/Swiss-Prot  Length:32

    Alignment length:30
                                    10        20        30
           PSBT_THEEB     1 METITYVFIFACIIALFFFAIFFREPPRIT  30
               SCOP domains ------------------------------ SCOP domains
               CATH domains ------------------------------ CATH domains
               Pfam domains PsbT-3kziT01 T:1-29          - Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------ PROSITE
                 Transcript ------------------------------ Transcript
                 3kzi T   1 METITYVFIFACIIALFFFAIFFREPPRIT  30
                                    10        20        30

Chain U from PDB  Type:PROTEIN  Length:97
 aligned with PSBU_THEEB | Q9F1L5 from UniProtKB/Swiss-Prot  Length:134

    Alignment length:97
                                    47        57        67        77        87        97       107       117       127       
           PSBU_THEEB    38 ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK 134
               SCOP domains ------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3kziU01 U:38-123 Photosystem II 12 kDa extrinsic protein                              ----------- CATH domains
               Pfam domains ---PsbU-3kziU01 U:41-133                                                                        - Pfam domains
         Sec.struct. author ...hhhhhhh.......ee....hhhhhhhh...hhhhhhhhhhh....hhhhhhhh...hhhhhhhhhhhh..ee....hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------- Transcript
                 3kzi U  38 ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK 134
                                    47        57        67        77        87        97       107       117       127

Chain V from PDB  Type:PROTEIN  Length:137
 aligned with CY550_THEEB | P0A386 from UniProtKB/Swiss-Prot  Length:163

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
          CY550_THEEB    27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY 163
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3kziV00 V:27-163 Cytochrome c                                                                                                             CATH domains
               Pfam domains -------------------------Cytochrom_C-3kziV01 V:52-147                                                                    ---------------- Pfam domains
         Sec.struct. author ...hhhhheee......eee.hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhh......hhhhhhhhh.................hhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------CYTC  PDB: V:50-149 UniProt: 50-149                                                                 -------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kzi V  27 AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY 163
                                    36        46        56        66        76        86        96       106       116       126       136       146       156

Chain X from PDB  Type:PROTEIN  Length:35
 aligned with PSBX_THEEB | Q9F1R6 from UniProtKB/Swiss-Prot  Length:41

    Alignment length:35
                                    11        21        31     
           PSBX_THEEB     2 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDK  36
               SCOP domains ----------------------------------- SCOP domains
               CATH domains ----------------------------------- CATH domains
               Pfam domains -PsbX-3kziX01 X:12-45               Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------- PROSITE
                 Transcript ----------------------------------- Transcript
                 3kzi X  11 TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDK  45
                                    20        30        40

Chain Z from PDB  Type:PROTEIN  Length:62
 aligned with PSBZ_THEEB | Q8DHJ2 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:62
                                    10        20        30        40        50        60  
           PSBZ_THEEB     1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV  62
               SCOP domains -------------------------------------------------------------- SCOP domains
               CATH domains 3kziZ00 Z:1-62 Helix hairpin bin                               CATH domains
               Pfam domains ---Ycf9-3kziZ01 Z:4-62                                         Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------- Transcript
                 3kzi Z   1 MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV  62
                                    10        20        30        40        50        60

Chain y from PDB  Type:PROTEIN  Length:28
 aligned with YCF12_THEEB | Q8DJI1 from UniProtKB/Swiss-Prot  Length:46

    Alignment length:28
                                    28        38        
          YCF12_THEEB    19 IAQLTMIAMIGIAGPMIIFLLAVRRGNL  46
               SCOP domains ---------------------------- SCOP domains
               CATH domains ---------------------------- CATH domains
               Pfam domains PSII_Ycf12-3kziy01 y:19-46   Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------- SAPs(SNPs)
                    PROSITE ---------------------------- PROSITE
                 Transcript ---------------------------- Transcript
                 3kzi y  19 IAQLTMIAMIGIAGPMIIFLLAVRRGNL  46
                                    28        38

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (8, 8)

Pfam Domains (16, 18)

Gene Ontology (30, 191)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PSBA1_THEEB | P0A444)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0010242	oxygen evolving activity	Catalysis of the reaction: 2 H2O = O2 + 4 H+ + 4 e-. The evolution of oxygen from oxidizing water is carried out by the oxygen evolving complex in photosystem II of plants. P680+, the photochemically oxidized reaction-center chlorophyll of PSII, is a strong biological oxidant. The reduction potential of P680+ is more positive than that of water, and thus it can oxidize water to give O2 and H+ ions. The oxygen escapes as a gas while the H+ ions remain in solution inside the thylakoid vesicle.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
	GO:0009635	response to herbicide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain B (PSBB_THEEB | Q8DIQ1)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009521	photosystem	A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain C (PSBC_THEEB | Q8DIF8)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009521	photosystem	A complex located in a photosynthetic membrane that consists of a photoreaction center associated with accessory pigments and electron carriers. Examples of this component are found in Arabidopsis thaliana and in photosynthetic bacterial and archaeal species.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain D (PSBD_THEEB | Q8CM25)

molecular function
	GO:0016168	chlorophyll binding	Interacting selectively and non-covalently with chlorophyll; any compound of magnesium complexed in a porphyrin (tetrapyrrole) ring and which functions as a photosynthetic pigment.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity	Enables the directed movement of electrons within the cyclic electron transport pathway of photosynthesis.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009772	photosynthetic electron transport in photosystem II	A photosynthetic electron transport chain in which electrons move from the primary electron acceptor (Quinone, Q) through a chain of electron transport molecules in the thylakoid membrane until they reach the ultimate electron acceptor of Photosystem II, which is plastocyanin (PC). The electron is then passed to the P700 chlorophyll a molecules of the reaction centre of photosystem I.
	GO:0018298	protein-chromophore linkage	The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain E (PSBE_THEEB | Q8DIP0)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain F (PSBF_THEEB | Q8DIN9)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0009767	photosynthetic electron transport chain	A process, occurring as part of photosynthesis, in which light provides the energy for a series of electron carriers to operate together to transfer electrons and generate a transmembrane electrochemical gradient.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain H (PSBH_THEEB | Q8DJ43)

molecular function
	GO:0042301	phosphate ion binding	Interacting selectively and non-covalently with phosphate.
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0050821	protein stabilization	Any process involved in maintaining the structure and integrity of a protein and preventing it from degradation or aggregation.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain I (PSBI_THEEB | Q8DJZ6)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain J (PSBJ_THEEB | P59087)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain K (PSBK_THEEB | Q9F1K9)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain L (PSBL_THEEB | Q8DIN8)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain M (PSBM_THEEB | Q8DHA7)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain O (PSBO_THEEB | P0A431)

molecular function
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009654	photosystem II oxygen evolving complex	A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain T (PSBT_THEEB | Q8DIQ0)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain U (PSBU_THEEB | Q9F1L5)

biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0019898	extrinsic component of membrane	The component of a membrane consisting of gene products and protein complexes that are loosely bound to one of its surfaces, but not integrated into the hydrophobic region.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009654	photosystem II oxygen evolving complex	A complex, composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins, that catalyzes the splitting of water to O2 and 4 H+. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ).
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain V (CY550_THEEB | P0A386)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0018063	cytochrome c-heme linkage	The linkage of cytochromes and other heme proteins to heme.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0019684	photosynthesis, light reaction	The light reactions of photosynthesis, which take place in photosystems II and I. Light energy is harvested and used to power the transfer of electrons among a series of electron donors and acceptors. The final electron acceptor is NADP+, which is reduced to NADPH. NADPH generated from light reactions is used in sugar synthesis in dark reactions. Light reactions also generate a proton motive force across the thylakoid membrane, and the proton gradient is used to synthesize ATP. There are two chemical reactions involved in the light reactions: water oxidation in photosystem II, and NADP reduction in photosystem I.
	GO:0022904	respiratory electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain X (PSBX_THEEB | Q9F1R6)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain Z (PSBZ_THEEB | Q8DHJ2)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
	GO:0042549	photosystem II stabilization	The stabilization of the photosystem II protein complex, resulting from the phosphorylation of its structural protein subunits, in a cell actively involved in photosynthesis.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009539	photosystem II reaction center	An integral membrane complex containing P680, the chlorophyll a molecule that functions as a primary electron donor. In the light, functioning as a water-plastoquinone oxidoreductase, it transfers electrons from water to plastoquinone.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Chain y (YCF12_THEEB | Q8DJI1)

biological process
	GO:0015979	photosynthesis	The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0009523	photosystem II	A photosystem that contains a pheophytin-quinone reaction center with associated accessory pigments and electron carriers. In cyanobacteria and chloroplasts, in the presence of light, PSII functions as a water-plastoquinone oxidoreductase, transferring electrons from water to plastoquinone, whereas other photosynthetic bacteria carry out anoxygenic photosynthesis and oxidize other compounds to re-reduce the photoreaction center.
	GO:0009579	thylakoid	A membranous cellular structure that bears the photosynthetic pigments in plants, algae, and cyanobacteria. In cyanobacteria thylakoids are of various shapes and are attached to, or continuous with, the plasma membrane. In eukaryotes they are flattened, membrane-bounded disk-like structures located in the chloroplasts; in the chloroplasts of higher plants the thylakoids form dense stacks called grana. Isolated thylakoid preparations can carry out photosynthetic electron transport and the associated phosphorylation.
	GO:0042651	thylakoid membrane	The pigmented membrane of any thylakoid.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (15, 87)

Sites (87, 87)

SS Bonds (1, 1)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 5)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (8, 8)

Pfam Domains (16, 18)

Gene Ontology (30, 191)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File