Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  C-DOMAIN OF HUMAN CARDIAC TROPONIN C IN COMPLEX WITH THE INHIBITORY REGION OF HUMAN CARDIAC TROPONIN I
 
Authors :  D. A. Lindhout, B. D. Sykes
Date :  09 Apr 03  (Deposition) - 16 Sep 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A,B  (30x)
Keywords :  Ef-Hand, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. A. Lindhout, B. D. Sykes
Structure And Dynamics Of The C-Domain Of Human Cardiac Troponin C In Complex With The Inhibitory Region Of Human Cardiac Troponin I.
J. Biol. Chem. V. 278 27024 2003
PubMed-ID: 12732641  |  Reference-DOI: 10.1074/JBC.M302497200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TROPONIN C, SLOW SKELETAL AND CARDIAC MUSCLES
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET
    Expression System Strain: BL21 DE3 (PLYSS)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: TNNC1 OR TNNC
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: TN-C
 
Molecule 2 - TROPONIN I, CARDIAC MUSCLE
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET
    Expression System Strain: BL21 DE3 (PLYSS)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: TNNI3 OR TNNC1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: CIP

 Structural Features

(-) Chains, Units

  
NMR Structure (30x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

NMR Structure (1, 2)
No.NameCountTypeFull Name
1CA2Ligand/IonCALCIUM ION

(-) Sites  (2, 2)

NMR Structure (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:105 , ASN A:107 , ASP A:109 , TYR A:111 , GLU A:116BINDING SITE FOR RESIDUE CA A 1
2AC2SOFTWAREASP A:141 , ASN A:143 , ASP A:145 , ARG A:147 , GLU A:152BINDING SITE FOR RESIDUE CA A 2

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1OZS)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1OZS)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (7, 7)

NMR Structure (7, 7)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_063072E134DTNNC1_HUMANDisease (CMH13)397516847AE134D
2UniProtVAR_019872R141QTNNI3_HUMANDisease (CMH7)397516347BR140Q
3UniProtVAR_016079L144QTNNI3_HUMANDisease (RCM1)121917760BL143Q
4UniProtVAR_007603R145GTNNI3_HUMANDisease (CMH7)104894724BR144G
5UniProtVAR_016080R145WTNNI3_HUMANDisease (RCM1)28934871BR144W
6UniProtVAR_063073D145ETNNC1_HUMANDisease (CMH13)267607124AD145E
7UniProtVAR_043988G159RTNNC1_HUMANDisease (CMD1Z)  ---AG159R

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

NMR Structure (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.TNNC1_HUMAN33-51
52-87
92-127
128-161
  2-
-
A:92-127
A:128-161
2EF_HAND_1PS00018 EF-hand calcium-binding domain.TNNC1_HUMAN65-77
105-117
141-153
  2-
A:105-117
A:141-153

(-) Exons   (4, 4)

NMR Structure (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002329751ENSE00001063786chr3:52488086-5248800879TNNC1_HUMAN1-880--
1.2bENST000002329752bENSE00000770833chr3:52486529-5248649931TNNC1_HUMAN9-19110--
1.3ENST000002329753ENSE00000770832chr3:52486268-52486122147TNNC1_HUMAN19-68500--
1.4bENST000002329754bENSE00000770831chr3:52485874-52485760115TNNC1_HUMAN68-106391A:89-106 (gaps)22
1.5cENST000002329755cENSE00000770830chr3:52485543-52485407137TNNC1_HUMAN106-152471A:106-15247
1.6ENST000002329756ENSE00001063787chr3:52485322-52485118205TNNC1_HUMAN152-161101A:152-16110

2.1ENST000003448871ENSE00001524342chr19:55669100-55668947154TNNI3_HUMAN1-440--
2.2ENST000003448872ENSE00001758167chr19:55668676-5566866413TNNI3_HUMAN4-850--
2.3ENST000003448873ENSE00001250420chr19:55668501-5566841884TNNI3_HUMAN9-36280--
2.4ENST000003448874ENSE00000727912chr19:55668012-5566797142TNNI3_HUMAN37-50140--
2.5ENST000003448875ENSE00000727909chr19:55667700-55667569132TNNI3_HUMAN51-94440--
2.6ENST000003448876ENSE00000417663chr19:55666198-5566610990TNNI3_HUMAN95-124300--
2.7ENST000003448877ENSE00000856455chr19:55665574-55665398177TNNI3_HUMAN125-183591B:128-14720
2.8ENST000003448878ENSE00001250409chr19:55663285-55663138148TNNI3_HUMAN184-210270--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:73
 aligned with TNNC1_HUMAN | P63316 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:77
                                    94       104       114       124       134       144       154       
          TNNC1_HUMAN    85 MKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE 161
               SCOP domains d1    ozsa_ A: Troponin C                                                     SCOP domains
               CATH domains 1o    zsA00 A:89-161 EF-hand                                                  CATH domains
           Pfam domains (1) --------EF_hand_5-1ozsA01 A:93-157                                       ---- Pfam domains (1)
           Pfam domains (2) --------------------------------EF_hand_6-1ozsA02 A:117-159                -- Pfam domains (2)
         Sec.struct. author ..----..hhhhhhhhhhhhh.....eehhhhhhhhhh........hhhhhhhhhhh......ee..hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------D----------E-------------R-- SAPs(SNPs)
                PROSITE (1) EF_----EF_HAND_2  PDB: A:92-127            EF_HAND_2  PDB: A:128-161          PROSITE (1)
                PROSITE (2) --------------------EF_HAND_1    -----------------------EF_HAND_1    -------- PROSITE (2)
           Transcript 1 (1) Exon 1.4b [INCOMPLETE]---------------------------------------------Exon 1.6   Transcript 1 (1)
           Transcript 1 (2) ---------------------Exon 1.5c  PDB: A:106-152 UniProt: 106-152     --------- Transcript 1 (2)
                 1ozs A  89 MK----GKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE 161
                             |    | 94       104       114       124       134       144       154       
                             |   91                                                                      
                            90                                                                           

Chain B from PDB  Type:PROTEIN  Length:20
 aligned with TNNI3_HUMAN | P19429 from UniProtKB/Swiss-Prot  Length:210

    Alignment length:20
                                   138       148
          TNNI3_HUMAN   129 TQKIFDLRGKFKRPTLRRVR 148
               SCOP domains -------------------- SCOP domains
               CATH domains -------------------- CATH domains
               Pfam domains -------------------- Pfam domains
         Sec.struct. author .................... Sec.struct. author
             SAPs(SNPs) (1) ------------Q--QG--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------W--- SAPs(SNPs) (2)
                    PROSITE -------------------- PROSITE
               Transcript 2 Exon 2.7             Transcript 2
                 1ozs B 128 TQKIFDLRGKFKRPTLRRVR 147
                                   137       147

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure

(-) Pfam Domains  (2, 2)

NMR Structure
(-)
Clan: EF_hand (270)

(-) Gene Ontology  (41, 52)

NMR Structure(hide GO term definitions)
Chain A   (TNNC1_HUMAN | P63316)
molecular function
    GO:0051015    actin filament binding    Interacting selectively and non-covalently with an actin filament, also known as F-actin, a helical filamentous polymer of globular G-actin subunits.
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0048306    calcium-dependent protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0031013    troponin I binding    Interacting selectively and non-covalently with troponin I, the inhibitory subunit of the troponin complex.
    GO:0031014    troponin T binding    Interacting selectively and non-covalently with troponin T, the tropomyosin-binding subunit of the troponin complex.
biological process
    GO:0060048    cardiac muscle contraction    Muscle contraction of cardiac muscle tissue.
    GO:0002086    diaphragm contraction    A process in which force is generated within involuntary skeletal muscle tissue, resulting in a change in muscle geometry. This process occurs in the diaphragm. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. The diaphragm is a striated muscle that is necessary for the process of respiratory gaseous exchange.
    GO:0030049    muscle filament sliding    The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
    GO:0043462    regulation of ATPase activity    Any process that modulates the rate of ATP hydrolysis by an ATPase.
    GO:0006937    regulation of muscle contraction    Any process that modulates the frequency, rate or extent of muscle contraction.
    GO:0032972    regulation of muscle filament sliding speed    Any process that modulates the velocity of muscle filament sliding.
    GO:0010038    response to metal ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
    GO:0014883    transition between fast and slow fiber    The process of conversion of fast-contracting muscle fibers to a slower character. This may involve slowing of contractile rate, slow myosin gene induction, increase in oxidative metabolic properties, altered electrophysiology and altered innervation. This process also regulates skeletal muscle adapatation.
    GO:0055010    ventricular cardiac muscle tissue morphogenesis    The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
    GO:0015629    actin cytoskeleton    The part of the cytoskeleton (the internal framework of a cell) composed of actin and associated proteins. Includes actin cytoskeleton-associated complexes.
    GO:0043292    contractile fiber    Fibers, composed of actin, myosin, and associated proteins, found in cells of smooth or striated muscle.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005861    troponin complex    A complex of accessory proteins (typically troponin T, troponin I and troponin C) found associated with actin in muscle thin filaments; involved in calcium regulation of muscle contraction.

Chain B   (TNNI3_HUMAN | P19429)
molecular function
    GO:0003779    actin binding    Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
    GO:0019855    calcium channel inhibitor activity    Stops, prevents, or reduces the activity of a calcium channel.
    GO:0048306    calcium-dependent protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules), in the presence of calcium.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0019904    protein domain specific binding    Interacting selectively and non-covalently with a specific domain of a protein.
    GO:0019901    protein kinase binding    Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
    GO:0030172    troponin C binding    Interacting selectively and non-covalently with troponin C, the calcium-binding subunit of the troponin complex.
    GO:0031014    troponin T binding    Interacting selectively and non-covalently with troponin T, the tropomyosin-binding subunit of the troponin complex.
biological process
    GO:0060048    cardiac muscle contraction    Muscle contraction of cardiac muscle tissue.
    GO:0006874    cellular calcium ion homeostasis    Any process involved in the maintenance of an internal steady state of calcium ions at the level of a cell.
    GO:0060047    heart contraction    The multicellular organismal process in which the heart decreases in volume in a characteristic way to propel blood through the body.
    GO:0007507    heart development    The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
    GO:0030049    muscle filament sliding    The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
    GO:0032780    negative regulation of ATPase activity    Any process that stops or reduces the rate of ATP hydrolysis by an ATPase.
    GO:1903779    regulation of cardiac conduction    Any process that modulates the frequency, rate or extent of cardiac conduction.
    GO:0006937    regulation of muscle contraction    Any process that modulates the frequency, rate or extent of muscle contraction.
    GO:0006940    regulation of smooth muscle contraction    Any process that modulates the frequency, rate or extent of smooth muscle contraction.
    GO:0001980    regulation of systemic arterial blood pressure by ischemic conditions    The process that modulates blood pressure by the detection of carbon dioxide levels in the brain stem. Increased levels activate the sympathetic vasoconstrictor mechanism increasing the force with which blood flows through the circulatory system.
    GO:0003009    skeletal muscle contraction    A process in which force is generated within skeletal muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. In the skeletal muscle, the muscle contraction takes advantage of an ordered sarcomeric structure and in most cases it is under voluntary control.
    GO:0006941    striated muscle contraction    A process in which force is generated within striated muscle tissue, resulting in the shortening of the muscle. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. Striated muscle is a type of muscle in which the repeating units (sarcomeres) of the contractile myofibrils are arranged in registry throughout the cell, resulting in transverse or oblique striations observable at the level of the light microscope.
    GO:0001570    vasculogenesis    The differentiation of endothelial cells from progenitor cells during blood vessel development, and the de novo formation of blood vessels and tubes.
    GO:0055010    ventricular cardiac muscle tissue morphogenesis    The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
    GO:0043292    contractile fiber    Fibers, composed of actin, myosin, and associated proteins, found in cells of smooth or striated muscle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0030016    myofibril    The contractile element of skeletal and cardiac muscle; a long, highly organized bundle of actin, myosin, and other proteins that contracts by a sliding filament mechanism.
    GO:0030017    sarcomere    The repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.
    GO:0005861    troponin complex    A complex of accessory proteins (typically troponin T, troponin I and troponin C) found associated with actin in muscle thin filaments; involved in calcium regulation of muscle contraction.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ozs)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ozs
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TNNC1_HUMAN | P63316
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  TNNI3_HUMAN | P19429
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  115210
    Disease Information: OMIM
  611879
    Disease Information: OMIM
  613243
    Disease Information: OMIM
  613690
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TNNC1_HUMAN | P63316
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TNNI3_HUMAN | P19429
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TNNC1_HUMAN | P63316: 1ap4 1ih0 1j1d 1j1e 1lj6 1lxf 1mxl 1spy 1wrk 1wrl 2jt0 2jt3 2jt8 2jtz 2jxl 2kdh 2kfx 2kgb 2krd 2l1r 2l98 2mkp 2mle 2mlf 2mzp 2n79 2n7l 3rv5 3sd6 3swb 4gje 4gjf 4gjg 4y99 5vln 5w88
        TNNI3_HUMAN | P19429: 1j1d 1j1e 1lxf 1mxl 2kgb 2krd 2l1r 2mzp 2n7l 4y99 5vln 5w88

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1OZS)