1NBD - JenaLib

Theor.Model - manually (Jmol Viewer)

Theoretical Model (Jmol Viewer)

Theor. Model - sites (Jmol Viewer)

Title :   CFTR NBD1, THEORETICAL MODEL

Authors :   P. J. Hoedemaeker, A. R. Davidson, D. R. Rose

Date :   27 Nov 96 (Deposition) - 15 May 97 (Release) - 15 May 97 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A

Keywords :   Regulator, Atp-Binding, Transmembrane, Transport, Glycoprotein, Duplication, Ionic Channel, Phosphorylation, Polymorphism, Disease Mutation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :

PubMed: search
(for further references see the PDB file header)

Molecule 1 - CFTR
	Chains	:	A
	Fragment	:	NBD1, FIRST (OR N-TERMINAL) NUCLEOTIDE-BINDING DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Synonym	:	CFTR NBD1, CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE REGULATOR NUCLEOTIDE-BINDING DOMAIN 1


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1NBD)

Theoretical Model (1, 1)

No.	Name	Evidence	Residues	Description
1	ATP	not defined	LYS A:464 , ASP A:572	PUTATIVE ATP BINDING SITE.

(no "SS Bond" information available for 1NBD)

(no "Cis Peptide Bond" information available for 1NBD)

Theoretical Model (50, 50)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_000160	A	455	E	CFTR_HUMAN	Disease (CF)	74551128	A	A	455	E
02	UniProt	VAR_000161	V	456	F	CFTR_HUMAN	Disease (CF)	397508195	A	V	456	F
03	UniProt	VAR_000162	G	458	V	CFTR_HUMAN	Disease (CF)	121909009	A	G	458	V
04	UniProt	VAR_000163	L	467	F	CFTR_HUMAN	Polymorphism	1800089	A	L	467	F
05	UniProt	VAR_000164	V	470	M	CFTR_HUMAN	Polymorphism	213950	A	M	470	M
06	UniProt	VAR_000165	G	480	C	CFTR_HUMAN	Disease (CF)	79282516	A	G	480	C
07	UniProt	VAR_000166	S	492	F	CFTR_HUMAN	Disease (CF)	121909017	A	S	492	F
08	UniProt	VAR_000167	E	504	Q	CFTR_HUMAN	Disease (CF)	397508223	A	E	504	Q
09	UniProt	VAR_009901	I	506	M	CFTR_HUMAN	Polymorphism	1800092	A	I	506	M
10	UniProt	VAR_000168	I	506	V	CFTR_HUMAN	Polymorphism	1800091	A	I	506	V
11	UniProt	VAR_000169	I	507	V	CFTR_HUMAN	Polymorphism	1800091	A	I	507	V
12	UniProt	VAR_000172	F	508	C	CFTR_HUMAN	Polymorphism	1800093	A	F	508	C
13	UniProt	VAR_000173	D	513	G	CFTR_HUMAN	Disease (CBAVD)	397508225	A	D	513	G
14	UniProt	VAR_000174	V	520	F	CFTR_HUMAN	Disease (CF)	77646904	A	V	520	F
15	UniProt	VAR_048150	K	532	E	CFTR_HUMAN	Polymorphism	35032490	A	K	532	E
16	UniProt	VAR_000175	G	544	V	CFTR_HUMAN	Disease (CBAVD)	397508241	A	G	544	V
17	UniProt	VAR_000177	S	549	I	CFTR_HUMAN	Disease (CF)	121908755	A	S	549	I
18	UniProt	VAR_000176	S	549	N	CFTR_HUMAN	Disease (CF)	121908755	A	S	549	N
19	UniProt	VAR_000178	S	549	R	CFTR_HUMAN	Disease (CF)	121909005	A	S	549	R
20	UniProt	VAR_000179	G	551	D	CFTR_HUMAN	Disease (CF)	75527207	A	G	551	D
21	UniProt	VAR_000180	G	551	S	CFTR_HUMAN	Disease (CF)	121909013	A	G	551	S
22	UniProt	VAR_000181	R	553	Q	CFTR_HUMAN	Disease (CF)	121909044	A	R	553	Q
23	UniProt	VAR_000182	L	558	S	CFTR_HUMAN	Disease (CF)	193922504	A	L	558	S
24	UniProt	VAR_000183	A	559	T	CFTR_HUMAN	Disease (CF)	75549581	A	A	559	T
25	UniProt	VAR_000184	R	560	K	CFTR_HUMAN	Disease (CF)	80055610	A	R	560	K
26	UniProt	VAR_000185	R	560	S	CFTR_HUMAN	Disease (CF)	397508267	A	R	560	S
27	UniProt	VAR_000186	R	560	T	CFTR_HUMAN	Disease (CF)	80055610	A	R	560	T
28	UniProt	VAR_000187	V	562	I	CFTR_HUMAN	Polymorphism	1800097	A	V	562	I
29	UniProt	VAR_000188	V	562	L	CFTR_HUMAN	Disease (CF)	1800097	A	V	562	L
30	UniProt	VAR_000189	Y	563	N	CFTR_HUMAN	Disease (CF)	121909006	A	Y	563	N
31	UniProt	VAR_000190	Y	569	C	CFTR_HUMAN	Disease (CF)	397508277	A	Y	569	C
32	UniProt	VAR_000191	Y	569	D	CFTR_HUMAN	Disease (CF)	397508276	A	Y	569	D
33	UniProt	VAR_000192	Y	569	H	CFTR_HUMAN	Disease (CF)	397508276	A	Y	569	H
34	UniProt	VAR_000193	L	571	S	CFTR_HUMAN	Disease (CF)	397508280	A	L	571	S
35	UniProt	VAR_000194	D	572	N	CFTR_HUMAN	Disease (CF)	397508282	A	D	572	N
36	UniProt	VAR_000195	P	574	H	CFTR_HUMAN	Disease (CF)	121908758	A	P	574	H
37	UniProt	VAR_000196	G	576	A	CFTR_HUMAN	Polymorphism	1800098	A	G	576	A
38	UniProt	VAR_000197	D	579	G	CFTR_HUMAN	Disease (CF)	397508288	A	D	579	G
39	UniProt	VAR_000198	I	601	F	CFTR_HUMAN	Disease (CF)	397508306	A	I	601	F
40	UniProt	VAR_048151	S	605	F	CFTR_HUMAN	Polymorphism	766874	A	S	605	F
41	UniProt	VAR_000199	L	610	S	CFTR_HUMAN	Disease (CF)	397508311	A	L	610	S
42	UniProt	VAR_000200	A	613	T	CFTR_HUMAN	Disease (CF)	201978662	A	A	613	T
43	UniProt	VAR_000201	D	614	G	CFTR_HUMAN	Disease (CF)	201124247	A	D	614	G
44	UniProt	VAR_000202	I	618	T	CFTR_HUMAN	Disease (CF)	139468767	A	I	618	T
45	UniProt	VAR_000203	L	619	S	CFTR_HUMAN	Disease (CF)	397508313	A	L	619	S
46	UniProt	VAR_000204	H	620	P	CFTR_HUMAN	Disease (CF)	397508314	A	H	620	P
47	UniProt	VAR_000205	H	620	Q	CFTR_HUMAN	Disease (CF)	397508315	A	H	620	Q
48	UniProt	VAR_000206	G	622	D	CFTR_HUMAN	Polymorphism	121908759	A	G	622	D
49	UniProt	VAR_000207	G	628	R	CFTR_HUMAN	Disease (CF)	397508316	A	G	628	R
50	UniProt	VAR_000208	L	633	P	CFTR_HUMAN	Disease (CF)	397508318	A	L	633	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Theoretical Model (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ABC_TRANSPORTER_1	PS00211	ABC transporters family signature.	CFTR_HUMAN	548-562	1	A:548-562

Theoretical Model (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3a	ENST00000003084	3a	ENSE00001343851	chr7:117120017-117120201	185	CFTR_HUMAN	1-18	18	0	-	-
1.4	ENST00000003084	4	ENSE00001708957	chr7:117144307-117144417	111	CFTR_HUMAN	18-55	38	0	-	-
1.5	ENST00000003084	5	ENSE00001778965	chr7:117149088-117149196	109	CFTR_HUMAN	55-91	37	0	-	-
1.6b	ENST00000003084	6b	ENSE00000718611	chr7:117170953-117171168	216	CFTR_HUMAN	92-163	72	0	-	-
1.7	ENST00000003084	7	ENSE00000718620	chr7:117174330-117174419	90	CFTR_HUMAN	164-193	30	0	-	-
1.8	ENST00000003084	8	ENSE00000718626	chr7:117175302-117175465	164	CFTR_HUMAN	194-248	55	0	-	-
1.9	ENST00000003084	9	ENSE00000718630	chr7:117176602-117176727	126	CFTR_HUMAN	248-290	43	0	-	-
1.10	ENST00000003084	10	ENSE00000718634	chr7:117180154-117180400	247	CFTR_HUMAN	290-372	83	0	-	-
1.11	ENST00000003084	11	ENSE00000718637	chr7:117182070-117182162	93	CFTR_HUMAN	373-403	31	0	-	-
1.12	ENST00000003084	12	ENSE00001738590	chr7:117188695-117188877	183	CFTR_HUMAN	404-464	61	1	A:425-464	40
1.13a	ENST00000003084	13a	ENSE00000718648	chr7:117199518-117199709	192	CFTR_HUMAN	465-528	64	1	A:465-528	64
1.15b	ENST00000003084	15b	ENSE00000718654	chr7:117227793-117227887	95	CFTR_HUMAN	529-560	32	1	A:529-560	32
1.16	ENST00000003084	16	ENSE00000718660	chr7:117230407-117230493	87	CFTR_HUMAN	560-589	30	1	A:560-589	30
1.17	ENST00000003084	17	ENSE00000718666	chr7:117231988-117232711	724	CFTR_HUMAN	589-830	242	1	A:589-638	50
1.18	ENST00000003084	18	ENSE00000718674	chr7:117234984-117235112	129	CFTR_HUMAN	831-873	43	0	-	-
1.19	ENST00000003084	19	ENSE00001015963	chr7:117242880-117242917	38	CFTR_HUMAN	874-886	13	0	-	-
1.20	ENST00000003084	20	ENSE00000977441	chr7:117243586-117243836	251	CFTR_HUMAN	886-970	85	0	-	-
1.21	ENST00000003084	21	ENSE00000977442	chr7:117246728-117246807	80	CFTR_HUMAN	970-996	27	0	-	-
1.22	ENST00000003084	22	ENSE00000718690	chr7:117250573-117250723	151	CFTR_HUMAN	997-1047	51	0	-	-
1.23a	ENST00000003084	23a	ENSE00000977443	chr7:117251635-117251862	228	CFTR_HUMAN	1047-1123	77	0	-	-
1.24	ENST00000003084	24	ENSE00000718699	chr7:117254667-117254767	101	CFTR_HUMAN	1123-1156	34	0	-	-
1.25a	ENST00000003084	25a	ENSE00000718704	chr7:117267576-117267824	249	CFTR_HUMAN	1157-1239	83	0	-	-
1.26	ENST00000003084	26	ENSE00000718708	chr7:117282492-117282647	156	CFTR_HUMAN	1240-1291	52	0	-	-
1.27	ENST00000003084	27	ENSE00000718713	chr7:117292896-117292985	90	CFTR_HUMAN	1292-1321	30	0	-	-
1.28	ENST00000003084	28	ENSE00000718718	chr7:117304742-117304914	173	CFTR_HUMAN	1322-1379	58	0	-	-
1.29	ENST00000003084	29	ENSE00000718724	chr7:117305513-117305618	106	CFTR_HUMAN	1379-1414	36	0	-	-
1.30b	ENST00000003084	30b	ENSE00001918100	chr7:117306962-117308715	1754	CFTR_HUMAN	1415-1480	66	0	-	-

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:214
 aligned with CFTR_HUMAN | P13569 from UniProtKB/Swiss-Prot  Length:1480

    Alignment length:214
                                   434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634    
           CFTR_HUMAN   425 DDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQP 638
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhh....................eeee.....hhhhhhhhhhhhh...........eeeeee.....hhhhhhhh.....eeeee.......hhhhhhh........eeeee............hhhhhhhhhhh..eeeeee......hhhhhhhhhhhh..........eeeeehhh....eeee....hhhhhhhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ------------------------------EF-V--------F--M---------C-----------F-----------Q-MVC----G------F-----------E-----------V----I-D-Q----STK-IN-----C-SN-H-A--G---------------------F---F----S--TG---TSP-D-----R----P----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------------------------------------------------V------------------------------------------N-S--------S-L------D--------------------------------------------------Q------------------ SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------------------------------------------------------------------------------R----------T--------H--------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------ABC_TRANSPORTER---------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.12  PDB: A:425-464 [INCOMPLETE]  Exon 1.13a  PDB: A:465-528 UniProt: 465-528                     Exon 1.15b  PDB: A:529-560      ----------------------------Exon 1.17  PDB: A:589-638 UniProt: 589-830         Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------------------------------Exon 1.16  PDB: A:560-589     ------------------------------------------------- Transcript 1 (2)
                 1nbd A 425 DDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQFSWIMPGTIKENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQP 638
                                   434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 1NBD)

(no "CATH Domain" information available for 1NBD)

(no "Pfam Domain" information available for 1NBD)

Theoretical Model(hide GO term definitions)

Chain A (CFTR_HUMAN | P13569)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0042626	ATPase activity, coupled to transmembrane movement of substances	Catalysis of the reaction: ATP + H2O = ADP + phosphate, to directly drive the active transport of a substance across a membrane.
	GO:0043225	ATPase-coupled anion transmembrane transporter activity	Catalysis of the transfer of a solute or solutes from one side of a membrane to the other according to the reaction: ATP + H2O + anion(out) = ADP + phosphate + anion(in).
	GO:0030165	PDZ domain binding	Interacting selectively and non-covalently with a PDZ domain of a protein, a domain found in diverse signaling proteins.
	GO:0015106	bicarbonate transmembrane transporter activity	Enables the transfer of bicarbonate from one side of a membrane to the other. Bicarbonate is the hydrogencarbonate ion, HCO3-.
	GO:0005254	chloride channel activity	Enables the facilitated diffusion of a chloride (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
	GO:0019869	chloride channel inhibitor activity	Stops, prevents, or reduces the activity of a chloride channel.
	GO:0017081	chloride channel regulator activity	Modulates the activity of a chloride channel.
	GO:0015108	chloride transmembrane transporter activity	Enables the transfer of chloride ions from one side of a membrane to the other.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0005260	intracellular ATPase-gated chloride channel activity	Enables passage of a chloride ion through a transmembrane channel that opens when intracellular ATP is bound and hydrolysed. Passage is via passive diffusion once the channel is open.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0015701	bicarbonate transport	The directed movement of bicarbonate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0071320	cellular response to cAMP	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:1902476	chloride transmembrane transport	The directed movement of chloride across a membrane.
	GO:0006821	chloride transport	The directed movement of chloride into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006695	cholesterol biosynthetic process	The chemical reactions and pathways resulting in the formation of cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones.
	GO:0030301	cholesterol transport	The directed movement of cholesterol, cholest-5-en-3-beta-ol, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0051454	intracellular pH elevation	Any process that increases the internal pH of a cell, measured by the concentration of the hydrogen ion.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0060081	membrane hyperpolarization	The process in which membrane potential increases with respect to its steady-state potential, usually from negative potential to a more negative potential. For example, during the repolarization phase of an action potential the membrane potential often becomes more negative or hyperpolarized before returning to the steady-state resting potential.
	GO:1902161	positive regulation of cyclic nucleotide-gated ion channel activity	Any process that activates or increases the frequency, rate or extent of cyclic nucleotide-gated ion channel activity.
	GO:0045921	positive regulation of exocytosis	Any process that activates or increases the frequency, rate or extent of exocytosis.
	GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	Any process that increases the frequency, rate or extent of the regulated release of insulin that contributes to the response of a cell to glucose.
	GO:1902943	positive regulation of voltage-gated chloride channel activity	Any process that activates or increases the frequency, rate or extent of voltage-gated chloride channel activity.
	GO:0007585	respiratory gaseous exchange	The process of gaseous exchange between an organism and its environment. In plants, microorganisms, and many small animals, air or water makes direct contact with the organism's cells or tissue fluids, and the processes of diffusion supply the organism with dioxygen (O2) and remove carbon dioxide (CO2). In larger animals the efficiency of gaseous exchange is improved by specialized respiratory organs, such as lungs and gills, which are ventilated by breathing mechanisms.
	GO:0048240	sperm capacitation	A process required for sperm to reach fertilization competence. Sperm undergo an incompletely understood series of morphological and molecular maturational processes, termed capacitation, involving, among other processes, protein tyrosine phosphorylation and increased intracellular calcium.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0006904	vesicle docking involved in exocytosis	The initial attachment of a vesicle membrane to a target membrane, mediated by proteins protruding from the membrane of the vesicle and the target membrane, that contributes to exocytosis.
cellular component
	GO:0030660	Golgi-associated vesicle membrane	The lipid bilayer surrounding a vesicle associated with the Golgi apparatus.
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0016323	basolateral plasma membrane	The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0034707	chloride channel complex	An ion channel complex through which chloride ions pass.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005769	early endosome	A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0031205	endoplasmic reticulum Sec complex	An endoplasmic reticulum membrane-associated complex involved in the translocation of proteins that are targeted to the ER. In yeast, this complex consists of two subcomplexes, namely, the Sec61 complex and the Sec62/Sec63 complex.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005765	lysosomal membrane	The lipid bilayer surrounding the lysosome and separating its contents from the cell cytoplasm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.
	GO:0055037	recycling endosome	An organelle consisting of a network of tubules that functions in targeting molecules, such as receptors transporters and lipids, to the plasma membrane.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1nbd)

	Sites
		ATP	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1nbd)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format \| Theor. Model - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1nbd
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CFTR_HUMAN \| P13569
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	219700
		Disease Information	:	OMIM
	277180
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CFTR_HUMAN \| P13569
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1NBD)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (50, 50)

PROSITE Motifs (1, 1)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (51, 51)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File