|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1JOR) |
Sites (0, 0)| (no "Site" information available for 1JOR) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1JOR) |
Cis Peptide Bonds (1, 30)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1JOR) |
PROSITE Motifs (3, 3)| NMR Structure (3, 3) |
Exons (0, 0)| (no "Exon" information available for 1JOR) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:149 aligned with NUC_STAAU | P00644 from UniProtKB/Swiss-Prot Length:231 Alignment length:149 92 102 112 122 132 142 152 162 172 182 192 202 212 222 NUC_STAAU 83 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWSEDNADSGQ 231 SCOP domains d1jora_ A: Staphylococcal nuclease SCOP domains CATH domains 1jorA00 A:1-149 [code=2.40.50.90, no name defined] CATH domains Pfam domains --------------------------------SNase-1jorA01 A:33-142 ------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -------TNASE_3 PDB: A:8-142 UniProt: 90-224 ------- PROSITE (1) PROSITE (2) ------------------TNASE_1 PDB: A:19-43 ---------------------------------------TNASE_2 -------------------------------------------------------- PROSITE (2) Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1jor A 1 ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ 149 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (8, 8)|
NMR Structure(hide GO term definitions) Chain A (NUC_STAAU | P00644)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|