1IGC - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   IGG1 FAB FRAGMENT (MOPC21) COMPLEX WITH DOMAIN III OF PROTEIN G FROM STREPTOCOCCUS

Authors :   J. P. Derrick, D. B. Wigley

Date :   05 Aug 94 (Deposition) - 03 Jun 95 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym./Biol. Unit : A,H,L

Keywords :   Protein G, Streptococcus, Complex (Antibody/Binding Protein) Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. P. Derrick, D. B. Wigley
The Third Igg-Binding Domain From Streptococcal Protein G. An Analysis By X-Ray Crystallography Of The Structure Alone And In A Complex With Fab.
J. Mol. Biol. V. 243 906 1994
PubMed-ID: 7966308 | Reference-DOI: 10.1006/JMBI.1994.1691
(for further references see the PDB file header)

Molecule 1 - IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN)
	Chains	:	L
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PUC18
	Expression System Strain	:	K12 JM101
	Expression System Taxid	:	562
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090

Molecule 2 - IGG1-KAPPA MOPC21 FAB (HEAVY CHAIN)
	Chains	:	H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PUC18
	Expression System Strain	:	K12 JM101
	Expression System Taxid	:	562
	Organism Common	:	HOUSE MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090

Molecule 3 - STREPTOCOCCAL PROTEIN G (DOMAIN III)
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PUC18
	Expression System Strain	:	K12 JM101
	Expression System Taxid	:	562
	Organism Scientific	:	STREPTOCOCCUS SP. G148
	Organism Taxid	:	1324

		1	2	3
Asymmetric/Biological Unit	:	A	H	L

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1IGC)

(no "Site" information available for 1IGC)

Asymmetric/Biological Unit

No.	Residues
1	H:22	-	H:96
2	H:147	-	H:202
3	L:23	-	L:88
4	L:134	-	L:193
5	L:213	-	H:222

Asymmetric/Biological Unit

No.	Residues
1	Ser L:7	-	Pro L:8
2	Tyr L:94	-	Pro L:95
3	Tyr H:102	-	Pro H:103
4	Phe H:153	-	Pro H:154
5	Glu H:155	-	Pro H:156

(no "SAP(SNP)/Variant" information available for 1IGC)

(no "PROSITE Motif" information available for 1IGC)

(no "Exon" information available for 1IGC)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:58
 aligned with SPG1_STRSG | P06654 from UniProtKB/Swiss-Prot  Length:448

    Alignment length:58
                                   304       314       324       334       344        
           SPG1_STRSG   295 AVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE 352
               SCOP domains d1igca_ A:                                                 SCOP domains
               CATH domains 1igcA00 A:4-61  [code=3.10.20.10, no name defined]         CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee...eeeeeeee..hhhhhhhhhhhhhhhh....eeeee....eeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                 1igc A   4 AVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE  61
                                    13        23        33        43        53

Chain H from PDB  Type:PROTEIN  Length:222
 aligned with HVM16_MOUSE | P01783 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:222
                                                                                                                                                 136                                                                                                      
                                    26        36        46        56        66        76        86        96       106       116       126       136         -         -         -         -         -         -         -         -         -         -  
          HVM16_MOUSE    17 DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARWGNYPYYAMDYWGQGTSVTVSS------------------------------------------------------------------------------------------------------   -
               SCOP domains d1igch1 H:1-119 Immunoglobulin heavy chain variable domain, VH                                                         d1igch2 H:120-222 Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma                         SCOP domains
               CATH domains 1igcH01 H:1-121 Immunoglobulins                                                                                          1igcH02 H:122-222 Immunoglobulins                                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee..eee.....eeeeeeee..hhhhh.eeeeee.....eeeeeee......eee.hhh....eeeee....eeeeee...hhhhheeeeeee..........ee...eeeee........eeeee..........eeeeeeeeeee.....eeee.........eeeeeee....eeeeeeeeee.hhhhhh.eeeeeeehhhheeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1igc H   1 DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTLHYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTGMYYCARWGNYPYYAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC 222
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220

Chain L from PDB  Type:PROTEIN  Length:213
 aligned with KV5A2_MOUSE | P01634 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:213
                                                                                                                                    136                                                                                                          
                                    39        49        59        69        79        89        99       109       119       129      |  -         -         -         -         -         -         -         -         -         -         -   
          KV5A2_MOUSE    30 NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIK----------------------------------------------------------------------------------------------------------   -
               SCOP domains d1igcl1 L:1-108 Immunoglobulin light chain kappa variable domain, VL-kappa                                  d1igcl2 L:109-213 Immunoglobulin light chain kappa constant domain, CL-kappa                              SCOP domains
               CATH domains 1igcL01 L:1-108 Immunoglobulins                                                                             1igcL02 L:109-210 Immunoglobulins                                                                     --- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eee....eee....eeeeee........eeeeee......eeeee...ee.........eee...eeeeee........eeeeeee......ee....eeeee......eeeee..hhhhhhh.eeeeeeeee.......eeeee.......................eeeeeeeeehhhhh.....eeeeee..eeeeeee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1igc L   1 NIVMTQSPKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGNSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 213
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Roll (3276)

Topology: Ubiquitin-like (UB roll) (674)

Homologous Superfamily: [code=3.10.20.10, no name defined] (72)

House mouse (Mus musculus) (6)

1igcA00

A:4-61

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: Immunoglobulins (2282)

House mouse (Mus musculus) (616)

2a	1igcL02	L:109-210
2b	1igcL01	L:1-108
2c	1igcH02	H:122-222
2d	1igcH01	H:1-121

(no "Pfam Domain" information available for 1IGC)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (SPG1_STRSG | P06654)

molecular function
	GO:0019864	IgG binding	Interacting selectively and non-covalently with an immunoglobulin of an IgG isotype.
biological process
	GO:0009405	pathogenesis	The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
	GO:0005618	cell wall	The rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal, most prokaryotic cells and some protozoan parasites, maintaining their shape and protecting them from osmotic lysis. In plants it is made of cellulose and, often, lignin; in fungi it is composed largely of polysaccharides; in bacteria it is composed of peptidoglycan; in protozoan parasites such as Giardia species, it's made of carbohydrates and proteins.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain H (HVM16_MOUSE | P01783)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
cellular component
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain L (KV5A2_MOUSE | P01634)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
biological process
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002377	immunoglobulin production	The appearance of immunoglobulin due to biosynthesis or secretion following a cellular stimulus, resulting in an increase in its intracellular or extracellular levels.
cellular component
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1igc)

	Sites
(no "Sites" information available for 1igc)

	Cis Peptide Bonds
		Glu H:155 - Pro H:156	[ RasMol ]
		Phe H:153 - Pro H:154	[ RasMol ]
		Ser L:7 - Pro L:8	[ RasMol ]
		Tyr H:102 - Pro H:103	[ RasMol ]
		Tyr L:94 - Pro L:95	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1igc
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HVM16_MOUSE \| P01783
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	KV5A2_MOUSE \| P01634
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	SPG1_STRSG \| P06654
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HVM16_MOUSE \| P01783
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	KV5A2_MOUSE \| P01634
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	SPG1_STRSG \| P06654
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1IGC)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (5, 5)

Cis Peptide Bonds (5, 5)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (5, 5)

CATH Domains (2, 5)

Pfam Domains (0, 0)

Gene Ontology (10, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File