|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (1, 1)
NMR Structure
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2RPV) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2RPV) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2RPV) |
Exons (0, 0)| (no "Exon" information available for 2RPV) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:75 aligned with SPG1_STRSG | P06654 from UniProtKB/Swiss-Prot Length:448 Alignment length:86 206 216 226 236 246 256 266 276 SPG1_STRSG 197 DYHKNLINNAKTVEGVKELIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 282 SCOP domains d2rp va_ A: au to mated matches SCOP domains CATH domains 2rpv A00 A:1-7 5 [code=3.10.20.10, no name defined] CATH domains Pfam domains --------------------------------IgG_binding_B-2rpvA01 A:22-75 Pfam domains
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (SPG1_STRSG | P06654)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|