|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2RMM) |
Sites (0, 0)| (no "Site" information available for 2RMM) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2RMM) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2RMM) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2RMM) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2RMM) |
Exons (0, 0)| (no "Exon" information available for 2RMM) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:56 aligned with SPG1_STRSG | P06654 from UniProtKB/Swiss-Prot Length:448 Alignment length:56 236 246 256 266 276 SPG1_STRSG 227 DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 282 SCOP domains d2rmma_ A: SCOP domains CATH domains 2rmmA00 A:1-56 [code=3.10.20.10, no name defined] CATH domains Pfam domains -------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 2rmm A 1 MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYFNDNGVDGEWTYDDATKTFTVTE 56 10 20 30 40 50 Chain B from PDB Type:PROTEIN Length:56 aligned with SPG1_STRSG | P06654 from UniProtKB/Swiss-Prot Length:448 Alignment length:56 236 246 256 266 276 SPG1_STRSG 227 DTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 282 SCOP domains d2rmmb_ B: SCOP domains CATH domains 2rmmB00 B:1-56 [code=3.10.20.10, no name defined] CATH domains Pfam domains (1) --IgG_binding_B-2rmmB01 B:3-56 Pfam domains (1) Pfam domains (2) --IgG_binding_B-2rmmB02 B:3-56 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------- PROSITE Transcript -------------------------------------------------------- Transcript 2rmm B 1 MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYFNDNGVDGEWTYDDATKTFTVTE 56 10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 2)
NMR Structure
|
CATH Domains (1, 2)| NMR Structure |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A,B (SPG1_STRSG | P06654)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|