|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3MP9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3MP9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3MP9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3MP9) |
Exons (0, 0)| (no "Exon" information available for 3MP9) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:61 aligned with SPG1_STRSG | P06654 from UniProtKB/Swiss-Prot Length:448 Alignment length:85 207 217 227 237 247 257 267 277 SPG1_STRSG 198 YHKNLINNAKTVEGVKELIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 282 SCOP domains d3m p9a_ A: SCOP domains CATH domains ------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 3mp9 A 4 HHH------------------------AMDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 64 | - - | 9 19 29 39 49 59 6 7 Chain B from PDB Type:PROTEIN Length:61 aligned with SPG1_STRSG | P06654 from UniProtKB/Swiss-Prot Length:448 Alignment length:85 207 217 227 237 247 257 267 277 SPG1_STRSG 198 YHKNLINNAKTVEGVKELIDEILAALPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 282 SCOP domains d3m p9b_ B: SCOP domains CATH domains ------------------------------------------------------------------------------------- CATH domains Pfam domains (1) ------------------------------IgG_binding_B-3mp9B01 B:10-64 Pfam domains (1) Pfam domains (2) ------------------------------IgG_binding_B-3mp9B02 B:10-64 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 3mp9 B 4 HHH------------------------AMDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE 64 | - - | 9 19 29 39 49 59 6 7
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3MP9) |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B (SPG1_STRSG | P06654)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|