Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE IMP DEHYDROGENASE FROM ASHBYA GOSSYPII BOUND TO GDP
 
Authors :  R. M. Buey, J. M. De Pereda, J. L. Revuelta
Date :  08 Apr 15  (Deposition) - 25 Nov 15  (Release) - 25 Nov 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.25
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (4x)
Biol. Unit 2:  C (4x),D (4x)
Biol. Unit 3:  C (4x),D (4x)
Keywords :  Imp Dehydrgoenase, Bateman Domain, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. M. Buey, R. Ledesma-Amaro, A. Velazquez-Campoy, M. Balsera, M. Chagoyen, J. M. De Pereda, J. L. Revuelta
Guanine Nucleotide Binding To The Bateman Domain Mediates The Allosteric Inhibition Of Eukaryotic Imp Dehydrogenases.
Nat Commun V. 6 8923 2015
PubMed-ID: 26558346  |  Reference-DOI: 10.1038/NCOMMS9923

(-) Compounds

Molecule 1 - INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE
    Chains: A, B, C, D
    EC Number: 1.1.1.205
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Taxid: 469008
    Gene: AGOS_AER117W
    Organism Scientific: ASHBYA GOSSYPII (STRAIN ATCC 10895)
    Organism Taxid: 284811
    Synonym: IMPDH

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (4x): AB  
Biological Unit 2 (4x):   C (4x)D (4x)
Biological Unit 3 (4x):   C (4x)D (4x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 24)

Asymmetric Unit (4, 24)
No.NameCountTypeFull Name
15GP4Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2ACT4Ligand/IonACETATE ION
3GDP12Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4K4Ligand/IonPOTASSIUM ION
Biological Unit 1 (3, 40)
No.NameCountTypeFull Name
15GP8Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2ACT8Ligand/IonACETATE ION
3GDP24Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4K-1Ligand/IonPOTASSIUM ION
Biological Unit 2 (3, 24)
No.NameCountTypeFull Name
15GP4Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2ACT8Ligand/IonACETATE ION
3GDP12Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4K-1Ligand/IonPOTASSIUM ION
Biological Unit 3 (2, 16)
No.NameCountTypeFull Name
15GP4Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2ACT-1Ligand/IonACETATE ION
3GDP12Ligand/IonGUANOSINE-5'-DIPHOSPHATE
4K-1Ligand/IonPOTASSIUM ION

(-) Sites  (24, 24)

Asymmetric Unit (24, 24)
No.NameEvidenceResiduesDescription
01AC1SOFTWARESER A:74 , MET A:76 , ARG A:325 , GLY A:331 , SER A:332 , ILE A:333 , CYS A:334 , THR A:336 , ASP A:367 , GLY A:368 , GLY A:369 , MET A:388 , GLY A:390 , GLY A:391 , TYR A:414 , GLY A:416 , MET A:417 , GLY A:418 , SER A:419 , GLN A:448 , GLY A:449 , HOH A:708 , HOH A:785binding site for residue 5GP A 601
02AC2SOFTWARETHR A:165 , SER A:166 , ASP A:168 , THR A:184 , ASP A:186 , VAL A:187 , ILE A:188 , LYS A:208 , GLY A:209 , HOH A:703 , HOH A:705 , HOH A:754 , HOH A:782 , HOH A:790 , HOH A:812 , ARG B:167 , LYS B:207binding site for residue GDP A 602
03AC3SOFTWARELYS A:115 , TYR A:116 , ASN A:118 , PRO A:124 , VAL A:125 , PHE A:145 , ALA A:146 , GLY A:147 , LYS A:210 , SER A:225 , THR A:227 , ASP A:228 , LYS A:231 , HOH A:742 , HOH A:773 , HOH A:775binding site for residue GDP A 603
04AC4SOFTWAREGLU A:117 , ASN A:118 , GLY A:119 , LEU A:196 , GLU A:197 , ASN A:200 , ASP A:228 , LEU A:229 , ASN A:232 , LYS A:240 , LYS A:245 , HOH A:701 , THR D:8 , GLU D:11binding site for residue GDP A 604
05AC5SOFTWAREGLY A:329 , GLY A:331 , CYS A:334 , GLU A:507 , GLY A:508 , GLY A:509binding site for residue K A 605
06AC6SOFTWARESER A:58 , THR A:66 , ASN A:68 , ASP D:5binding site for residue ACT A 606
07AC7SOFTWARESER B:74 , MET B:76 , ASN B:306 , ARG B:325 , GLY B:331 , SER B:332 , CYS B:334 , THR B:336 , ASP B:367 , GLY B:369 , MET B:388 , GLY B:390 , GLY B:391 , TYR B:414 , GLY B:416 , MET B:417 , GLY B:418 , GLN B:448 , HOH B:736 , HOH B:790binding site for residue 5GP B 601
08AC8SOFTWAREARG A:167 , LYS A:207 , THR B:165 , SER B:166 , ARG B:167 , ASP B:168 , THR B:184 , ASP B:186 , VAL B:187 , ILE B:188 , LYS B:208 , GLY B:209 , HOH B:734 , HOH B:743 , HOH B:764 , HOH B:783binding site for residue GDP B 602
09AC9SOFTWARELYS B:115 , TYR B:116 , ASN B:118 , PRO B:124 , VAL B:125 , PHE B:145 , ALA B:146 , GLY B:147 , LYS B:210 , SER B:225 , THR B:227 , ASP B:228 , LYS B:231 , HOH B:709 , HOH B:711 , HOH B:727binding site for residue GDP B 603
10AD1SOFTWAREGLU B:117 , ASN B:118 , GLY B:119 , ASN B:200 , ASP B:228 , LEU B:229 , ASN B:232 , PRO B:236 , LYS B:240 , LYS B:245binding site for residue GDP B 604
11AD2SOFTWAREGLY B:329 , GLY B:331 , CYS B:334 , GLU B:507 , GLY B:508 , GLY B:509binding site for residue K B 605
12AD3SOFTWARELEU B:91 , ILE B:464binding site for residue ACT B 606
13AD4SOFTWARESER C:74 , MET C:76 , ASN C:306 , ARG C:325 , GLY C:331 , SER C:332 , ILE C:333 , CYS C:334 , THR C:336 , ASP C:367 , GLY C:369 , MET C:388 , GLY C:390 , GLY C:391 , TYR C:414 , GLY C:416 , MET C:417 , GLY C:418 , GLN C:448 , GLY C:449 , ACT C:606 , HOH C:738 , HOH C:746binding site for residue 5GP C 601
14AD5SOFTWARETHR C:165 , SER C:166 , ASP C:168 , THR C:184 , ASP C:186 , VAL C:187 , ILE C:188 , LYS C:208 , GLY C:209 , ARG D:167 , LYS D:207binding site for residue GDP C 602
15AD6SOFTWARELYS C:115 , TYR C:116 , ASN C:118 , ILE C:121 , PRO C:124 , VAL C:125 , PHE C:145 , ALA C:146 , GLY C:147 , LYS C:210 , SER C:225 , THR C:227 , ASP C:228 , LYS C:231 , HOH C:712binding site for residue GDP C 603
16AD7SOFTWAREALA B:7 , GLU B:11 , HIS B:318 , GLU C:117 , ASN C:118 , GLY C:119 , LEU C:196 , ASN C:200 , ASP C:228 , LEU C:229 , ASN C:232 , LYS C:240 , LYS C:245binding site for residue GDP C 604
17AD8SOFTWAREGLY C:329 , GLY C:331 , CYS C:334 , GLU C:507 , GLY C:508 , GLY C:509binding site for residue K C 605
18AD9SOFTWAREASP C:277 , SER C:278 , ARG C:325 , 5GP C:601binding site for residue ACT C 606
19AE1SOFTWARELEU C:91 , TYR C:468binding site for residue ACT C 607
20AE2SOFTWARESER D:74 , MET D:76 , ARG D:325 , GLY D:331 , SER D:332 , ILE D:333 , CYS D:334 , THR D:336 , ASP D:367 , GLY D:369 , MET D:388 , GLY D:390 , GLY D:391 , TYR D:414 , GLY D:416 , MET D:417 , GLY D:418 , GLN D:448 , GLY D:449 , HOH D:712 , HOH D:739binding site for residue 5GP D 600
21AE3SOFTWAREARG C:167 , LYS C:207 , THR D:165 , SER D:166 , ARG D:167 , ASP D:168 , THR D:184 , ASP D:186 , VAL D:187 , ILE D:188 , LYS D:208 , GLY D:209 , HOH D:701 , HOH D:758binding site for residue GDP D 601
22AE4SOFTWARELYS D:115 , TYR D:116 , ASN D:118 , PRO D:124 , VAL D:125 , PHE D:145 , ALA D:146 , GLY D:147 , LYS D:210 , SER D:225 , THR D:227 , ASP D:228 , LYS D:231 , HOH D:758binding site for residue GDP D 602
23AE5SOFTWAREGLU D:117 , ASN D:118 , GLY D:119 , ASN D:200 , ASP D:228 , ASN D:232 , LYS D:240 , LYS D:245 , HOH D:711binding site for residue GDP D 603
24AE6SOFTWAREGLY D:329 , GLY D:331 , CYS D:334 , GLU D:507 , GLY D:508 , GLY D:509binding site for residue K D 604

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4Z87)

(-) Cis Peptide Bonds  (13, 13)

Asymmetric Unit
No.Residues
1Phe A:143 -Gly A:144
2Gly A:305 -Asn A:306
3Pro A:400 -Gly A:401
4Ser B:30 -Lys B:31
5Lys B:31 -Thr B:32
6Thr B:32 -Arg B:33
7Phe B:143 -Gly B:144
8Gly B:305 -Asn B:306
9Phe C:143 -Gly C:144
10Gly C:305 -Asn C:306
11Pro C:400 -Gly C:401
12Phe D:143 -Gly D:144
13Gly D:305 -Asn D:306

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4Z87)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4Z87)

(-) Exons   (0, 0)

(no "Exon" information available for 4Z87)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:498
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....hhhhhhhhhhhh......hhhhhh.....hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhh.....ee.........hhhhhhhhhhhhh...eeee........eeeeehhhhhh.......hhhhhh......ee...hhhhhhhhhhhhh..eeeee.....eeeeeehhhhhhhhhh..............eeee...hhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhh..eeee........hhhhhhh...hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeee..............eee..eeeeeee...hhhhhh......eeeee...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee.hhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4z87 A   0 HMTYRDAATALEHLATYAEKDGLSVEQLMDRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTDDGKPTGKLQGIITSRDIQFVEDETLLVSEIMTKDVITGKQGINLEEANQILKNTKKGKLPIVDEAGCLVSMLSRTDLMKNQSYPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRDGKRLKTYRGMGSIDAMQKVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYELFD 522
                                     9        19        29|       42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422  ||   452       462       472       482       492       502       512    ||  
                                                        29|                                                                                                                                                                                                                                                                                                                                                                                                     425|                                                                    517|  
                                                         33                                                                                                                                                                                                                                                                                                                                                                                                      446                                                                     520  


Chain B from PDB  Type:PROTEIN  Length:498
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh......hhhhhh........hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhhh...............hhhhhhhhhhhhh...eeee........eeeeehhhhhh.......hhhhhh......ee...hhhhhhhhhhhhh..eeeee.....eeeeeehhhhhhhhhh..............eeee...hhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhh...eeee........hhhhhhh...hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeee..............eee..eeeeeee...hhhhhh.....eeeee...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee.hhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4z87 B   2 TYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTDDGKPTGKLQGIITSRDIQFVEDETLLVSEIMTKDVITGKQGINLEEANQILKNTKKGKLPIVDEAGCLVSMLSRTDLMKNQSYPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRDGKRLKTYRGMGSIDAMQVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYELFD 522
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421  ||   452       462       472       482       492       502       512    ||  
                                                                                                                                                                                                                                                                                                                                                                                                                                                                424|                                                                    517|  
                                                                                                                                                                                                                                                                                                                                                                                                                                                                 446                                                                     520  


Chain C from PDB  Type:PROTEIN  Length:495
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh......hhhhhh.....hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh...eeee.......eeeeehhhhhh.......hhhhhh......ee...hhhhhhhhhhhhh..eeeee.....eeeeeehhhhhhhhhh..............eeee...hhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhh..eeee........hhhhhhh...hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeee....................eeeee...hhhhhh.......eeeee...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee.hhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z87 C   2 TYRDAATALEHLATYAEKDGLSVEQLMDSGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTDDGKPGKLQGIITSRDIQFVEDETLLVSEIMTKDVITGKQGINLEEANQILKNTKKGKLPIVDEAGCLVSMLSRTDLMKNQSYPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFDGKRLKTYRGMGSIDAMQVLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYEKLF 521
                                    11        21        34        44        54        64        74        84        94       104       114       124       134       144       154 ||    165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405|      416       445       455       465       475       485       495       505       515  || 
                                                       30|                                                                                                                       156|                                                                                                                                                                                                                                                    405|              424|                                                                       518| 
                                                        34                                                                                                                        158                                                                                                                                                                                                                                                     407               444                                                                        520 


Chain D from PDB  Type:PROTEIN  Length:484
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh......hhhhhh....hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhh................hhhhhhhhhhhhh...eeee........eeeeehhhhhh.......hhhhhh......ee...hhhhhhhhhhhhh..eeeee.....eeeeeehhhhhhhhhh..............eeee...hhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhh..eeee........hhhhhhh...hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeee............eeee..eeeeeee........eeeee...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee.hhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4z87 D   2 TYRDAATALEHLATYAEKDGLSVEQLMDGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENGFINAPVVVGPDATVADVRRMKNEFGFAGFPVTDDGKPTGKLQGIITSRDIQFVEDETLLVSEIMTKDVITGKQGINLEEANQILKNTKKGKLPIVDEAGCLVSMLSRTDLMKNQSYPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPEYFFRDGKRLKTYRGMGSAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYE 517
                                    11        21       |35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395    || 406       416  ||   453       463       473       483       493       503       513    
                                                      29|                                                                                                                                                                                                                                                                                                                                                                           400|              419|                                                                      
                                                       34                                                                                                                                                                                                                                                                                                                                                                            402               447
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4Z87)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4Z87)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4Z87)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5GP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ACT  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GDP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    K  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
    AD8  [ RasMol ]  +environment [ RasMol ]
    AD9  [ RasMol ]  +environment [ RasMol ]
    AE1  [ RasMol ]  +environment [ RasMol ]
    AE2  [ RasMol ]  +environment [ RasMol ]
    AE3  [ RasMol ]  +environment [ RasMol ]
    AE4  [ RasMol ]  +environment [ RasMol ]
    AE5  [ RasMol ]  +environment [ RasMol ]
    AE6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:305 - Asn A:306   [ RasMol ]  
    Gly B:305 - Asn B:306   [ RasMol ]  
    Gly C:305 - Asn C:306   [ RasMol ]  
    Gly D:305 - Asn D:306   [ RasMol ]  
    Lys B:31 - Thr B:32   [ RasMol ]  
    Phe A:143 - Gly A:144   [ RasMol ]  
    Phe B:143 - Gly B:144   [ RasMol ]  
    Phe C:143 - Gly C:144   [ RasMol ]  
    Phe D:143 - Gly D:144   [ RasMol ]  
    Pro A:400 - Gly A:401   [ RasMol ]  
    Pro C:400 - Gly C:401   [ RasMol ]  
    Ser B:30 - Lys B:31   [ RasMol ]  
    Thr B:32 - Arg B:33   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4z87
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q756Z6_ASHGO | Q756Z6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.205
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q756Z6_ASHGO | Q756Z6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q756Z6_ASHGO | Q756Z6: 5mcp 5tc3
UniProtKB/TrEMBL
        Q756Z6_ASHGO | Q756Z6: 4xtd 4xti 4xwu 4z0g

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4Z87)