4Z0G - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF THE IMPDH FROM ASHBYA GOSSYPII BOUND TO GMP

Authors :   R. M. Buey, J. M. De Pereda, J. L. Revuelta

Date :   26 Mar 15 (Deposition) - 25 Nov 15 (Release) - 25 Nov 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.25

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (4x)
Biol. Unit 2: B  (4x)

Keywords :   Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. M. Buey, R. Ledesma-Amaro, A. Velazquez-Campoy, M. Balsera, M. Chagoyen, J. M. De Pereda, J. L. Revuelta
Guanine Nucleotide Binding To The Bateman Domain Mediates The Allosteric Inhibition Of Eukaryotic Imp Dehydrogenases.
Nat Commun V. 6 8923 2015
PubMed-ID: 26558346 | Reference-DOI: 10.1038/NCOMMS9923

Molecule 1 - INOSINE-5'-MONOPHOSPHATE DEHYDROGENASE,INOSINE-5'- MONOPHOSPHATE DEHYDROGENASE
	Chains	:	A, B
	EC Number	:	1.1.1.205, 1.1.1.205
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	UNP RESIDUES 1-119,UNP RESIDUES 236-522
	Gene	:	AGOS_AER117W
	Mutation	:	YES
	Organism Scientific	:	ASHBYA GOSSYPII (STRAIN ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
	Organism Taxid	:	284811
	Synonym	:	IMPDH,IMPDH

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (4x)	:	A
Biological Unit 2 (4x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 8)

No.	Name	Count	Type	Full Name
1	5GP	4	Ligand/Ion	GUANOSINE-5'-MONOPHOSPHATE
2	GOL	2	Ligand/Ion	GLYCEROL
3	K	2	Ligand/Ion	POTASSIUM ION

Biological Unit 1 (2, 12)

No.	Name	Count	Type	Full Name
1	5GP	8	Ligand/Ion	GUANOSINE-5'-MONOPHOSPHATE
2	GOL	4	Ligand/Ion	GLYCEROL
3	K	-1	Ligand/Ion	POTASSIUM ION

Biological Unit 2 (2, 12)

No.	Name	Count	Type	Full Name
1	5GP	8	Ligand/Ion	GUANOSINE-5'-MONOPHOSPHATE
2	GOL	4	Ligand/Ion	GLYCEROL
3	K	-1	Ligand/Ion	POTASSIUM ION

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:74 , MET A:76 , ASN A:306 , ARG A:325 , GLY A:331 , SER A:332 , ILE A:333 , CYS A:334 , THR A:336 , ASP A:367 , GLY A:369 , MET A:388 , GLY A:390 , GLY A:391 , TYR A:414 , GLY A:416 , MET A:417 , GLY A:418 , GLN A:448 , GLY A:449 , GOL A:603 , HOH A:729 , HOH A:766 , HOH A:769 , HOH A:807 , HOH A:809 , HOH A:872	binding site for residue 5GP A 600
2	AC2	SOFTWARE	ILE A:48 , PHE A:50 , PRO A:51 , SER A:52 , SER A:283 , VAL A:284 , PHE A:285 , HIS A:473 , GLN A:476 , HOH A:718 , HOH A:885 , HOH A:911 , HOH A:945 , GLU B:295	binding site for residue 5GP A 601
3	AC3	SOFTWARE	GLY A:329 , GLY A:331 , CYS A:334 , GLU A:507 , GLY A:508 , GLY A:509	binding site for residue K A 602
4	AC4	SOFTWARE	ASP A:277 , SER A:278 , SER A:279 , ASN A:306 , MET A:417 , 5GP A:600 , HOH A:715 , HOH A:951	binding site for residue GOL A 603
5	AC5	SOFTWARE	SER B:74 , MET B:76 , ASN B:306 , ARG B:325 , GLY B:331 , SER B:332 , ILE B:333 , CYS B:334 , THR B:336 , ASP B:367 , GLY B:369 , MET B:388 , GLY B:390 , GLY B:391 , TYR B:414 , GLY B:416 , MET B:417 , GLY B:418 , GLN B:448 , GLY B:449 , GOL B:603 , HOH B:733 , HOH B:770 , HOH B:804 , HOH B:809 , HOH B:810 , HOH B:857	binding site for residue 5GP B 600
6	AC6	SOFTWARE	ILE B:48 , PHE B:50 , PRO B:51 , SER B:52 , SER B:283 , VAL B:284 , PHE B:285 , HIS B:473 , GLN B:476 , HOH B:745 , HOH B:760 , HOH B:780 , HOH B:863 , HOH B:869 , HOH B:916	binding site for residue 5GP B 601
7	AC7	SOFTWARE	GLY B:329 , GLY B:331 , CYS B:334 , GLU B:507 , GLY B:508 , GLY B:509	binding site for residue K B 602
8	AC8	SOFTWARE	ASP B:277 , SER B:278 , ASN B:306 , MET B:417 , 5GP B:600 , HOH B:940	binding site for residue GOL B 603

(no "SS Bond" information available for 4Z0G)

Asymmetric Unit

No.	Residues
1	Gly A:305	-	Asn A:306
2	Thr B:32	-	Arg B:33
3	Gly B:305	-	Asn B:306

(no "SAP(SNP)/Variant" information available for 4Z0G)

(no "PROSITE Motif" information available for 4Z0G)

(no "Exon" information available for 4Z0G)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:384
                                                                                                                                                                                                                                                                                                                                                                                                                                
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhh......hhhhhhh....hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhhh..................eeee...hhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhh..eeee........hhhhhhh...hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeee..............ee...eeeeee...hhhhhh........eeeee...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee.hhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4z0g A   2 TYRDAATALEHLATYAEKDGLSVEQLMDRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENDGPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRGKRLKTYRGMGSIDAMQKVLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYEKRLFD 522
                                    11        21       |34        44        54        64        74        84        94       104       114   ||  239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399      |410       420    || 448       458       468       478       488       498       508       518    
                                                      29|                                                                                  118|                                                                                                                                                                         406|              425|                                                                              
                                                       33                                                                                   234                                                                                                                                                                          408               444

Chain B from PDB  Type:PROTEIN  Length:390
                                                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhh......hhhhhhh.....hhh.eee.......hhhhh...ee.....ee...eee.......hhhhhhhhhhh..eeee....hhhhhhhhhhhhhh...................eeee...hhhhhhhhhhhhh...eeee......hhhhhhhhhhhhhhh...eeeeeee.hhhhhhhhhhhh..eeee........hhhhhhh...hhhhhhhhhhhhhhhhh..eeee....hhhhhhhhhhh...eeee..............ee...eeeeee...hhhhhh............eeeee...hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....eee.hhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4z0g B   1 MTYRDAATALEHLATYAEKDGLSVEQLMDTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENDGPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRGKRLKTYRGMGSIDAMQKTDVKVLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYEKRLFD 522
                                    10        20        32        42        52        62        72        82        92       102       112     ||237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       408       418       428||     452       462       472       482       492       502       512       522
                                                       29|                                                                                   118|                                                                                                                                                                         406|                  429|                                                                              
                                                        32                                                                                    234                                                                                                                                                                          408                   444

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4Z0G)

(no "CATH Domain" information available for 4Z0G)

(no "Pfam Domain" information available for 4Z0G)

Asymmetric Unit(hide GO term definitions)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		5GP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gly A:305 - Asn A:306	[ RasMol ]
		Gly B:305 - Asn B:306	[ RasMol ]
		Thr B:32 - Arg B:33	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4z0g
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q756Z6_ASHGO \| Q756Z6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	1.1.1.205
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q756Z6_ASHGO \| Q756Z6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	Q756Z6_ASHGO \| Q756Z6	:	5mcp 5tc3
UniProtKB/TrEMBL
	Q756Z6_ASHGO \| Q756Z6	:	4xtd 4xti 4xwu 4z87

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 8)

Sites (8, 8)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File