|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (2, 16) Biological Unit 2 (1, 12) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (8, 8)
Asymmetric Unit
|
||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3QQT) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3QQT) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3QQT) |
Exons (0, 0)| (no "Exon" information available for 3QQT) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:70 aligned with HYP2_HYPJE | P79073 from UniProtKB/Swiss-Prot Length:86 Alignment length:70 25 35 45 55 65 75 85 HYP2_HYPJE 16 AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGT 85 SCOP domains d3qqta_ A: Hydrophobin II, HfbII SCOP domains CATH domains ---------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 3qqt A 1 AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGT 70 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:70 aligned with HYP2_HYPJE | P79073 from UniProtKB/Swiss-Prot Length:86 Alignment length:70 25 35 45 55 65 75 85 HYP2_HYPJE 16 AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGT 85 SCOP domains d3qqtb_ B: Hydrophobin II, HfbII SCOP domains CATH domains ---------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 3qqt B 1 AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGT 70 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3QQT) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3QQT) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A,B (HYP2_HYPJE | P79073)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|