|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 2) |
Asymmetric Unit (2, 2)
|
Asymmetric/Biological Unit
|
(no "Cis Peptide Bond" information available for 2PL7) |
(no "SAP(SNP)/Variant" information available for 2PL7) |
(no "PROSITE Motif" information available for 2PL7) |
(no "Exon" information available for 2PL7) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:67 aligned with HYP2_HYPJE | P79073 from UniProtKB/Swiss-Prot Length:86 Alignment length:67 25 35 45 55 65 75 HYP2_HYPJE 16 AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKA 82 SCOP domains d2pl7a_ A: Hydrophobin II, HfbII SCOP domains CATH domains 2pl7A00 A:1-67 hfbii hydrophobin CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 2pl7 A 1 AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKA 67 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:67 aligned with HYP2_HYPJE | P79073 from UniProtKB/Swiss-Prot Length:86 Alignment length:67 25 35 45 55 65 75 HYP2_HYPJE 16 AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKA 82 SCOP domains d2pl7b_ B: Hydrophobin II, HfbII SCOP domains CATH domains 2pl7B00 B:1-67 hfbii hydrophobin CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 2pl7 B 1 AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKA 67 10 20 30 40 50 60
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 2PL7) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (HYP2_HYPJE | P79073)
|
|
|
|
|
|
|