|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 12) Biological Unit 1 (1, 20) Biological Unit 2 (1, 8) Biological Unit 3 (0, 0) Biological Unit 4 (1, 2) Biological Unit 5 (1, 6) Biological Unit 6 (1, 2) Biological Unit 7 (0, 0) |
Asymmetric Unit (11, 11)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 2GVM) |
(no "SAP(SNP)/Variant" information available for 2GVM) |
(no "PROSITE Motif" information available for 2GVM) |
(no "Exon" information available for 2GVM) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:70 aligned with HYP1_HYPJE | P52754 from UniProtKB/Swiss-Prot Length:97 Alignment length:70 37 47 57 67 77 87 97 HYP1_HYPJE 28 NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA 97 SCOP domains d2gvma_ A: automated matches SCOP domains CATH domains 2gvmA00 A:6-75 hfbii hydrophobin CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 2gvm A 6 NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA 75 15 25 35 45 55 65 75 Chain B from PDB Type:PROTEIN Length:70 aligned with HYP1_HYPJE | P52754 from UniProtKB/Swiss-Prot Length:97 Alignment length:70 37 47 57 67 77 87 97 HYP1_HYPJE 28 NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA 97 SCOP domains d2gvmb_ B: automated matches SCOP domains CATH domains 2gvmB00 B:6-75 hfbii hydrophobin CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 2gvm B 6 NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA 75 15 25 35 45 55 65 75 Chain C from PDB Type:PROTEIN Length:70 aligned with HYP1_HYPJE | P52754 from UniProtKB/Swiss-Prot Length:97 Alignment length:70 37 47 57 67 77 87 97 HYP1_HYPJE 28 NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA 97 SCOP domains d2gvmc_ C: automated matches SCOP domains CATH domains 2gvmC00 C:6-75 hfbii hydrophobin CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 2gvm C 6 NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA 75 15 25 35 45 55 65 75 Chain D from PDB Type:PROTEIN Length:70 aligned with HYP1_HYPJE | P52754 from UniProtKB/Swiss-Prot Length:97 Alignment length:70 37 47 57 67 77 87 97 HYP1_HYPJE 28 NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA 97 SCOP domains d2gvmd_ D: automated matches SCOP domains CATH domains 2gvmD00 D:6-75 hfbii hydrophobin CATH domains Pfam domains ---------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 2gvm D 6 NVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA 75 15 25 35 45 55 65 75
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 2GVM) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (HYP1_HYPJE | P52754)
|
|
|
|
|
|
|