|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1WTQ) |
Sites (0, 0)| (no "Site" information available for 1WTQ) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1WTQ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1WTQ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1WTQ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1WTQ) |
Exons (0, 0)| (no "Exon" information available for 1WTQ) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:64 aligned with DN7D_SULAC | P13123 from UniProtKB/Swiss-Prot Length:66 Alignment length:64 11 21 31 41 51 61 DN7D_SULAC 2 VKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK 65 SCOP domains d1wtqa_ A: automated matches SCOP domains CATH domains 1wtqA00 A:2-65 [code=2.40.50.40, no name defined] CATH domains Pfam domains ---------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------- Transcript 1wtq A 2 VKVKFKYKGEEKEVDTSKIKKVWRVGKFVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK 65 11 21 31 41 51 61
Chain B from PDB Type:DNA Length:8
1wtq B 101 GTAATTAC 108
Chain C from PDB Type:DNA Length:8
1wtq C 109 GTAATTAC 116
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1WTQ) |
Gene Ontology (3, 3)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (DN7D_SULAC | P13123)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|