1C9B | PD0112 - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF A HUMAN TBP CORE DOMAIN-HUMAN TFIIB CORE DOMAIN COMPLEX BOUND TO AN EXTENDED, MODIFIED ADENOVIRAL MAJOR LATE PROMOTER (ADMLP)

Authors :   F. T. F. Tsai, P. B. Sigler

Date :   01 Aug 99 (Deposition) - 10 Jan 00 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.65

Chains :   Asym. Unit : A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T
Biol. Unit 1: A,B,C,D  (1x)
Biol. Unit 2: E,F,G,H  (1x)
Biol. Unit 3: I,J,K,L  (1x)
Biol. Unit 4: M,N,O,P  (1x)
Biol. Unit 5: Q,R,S,T  (1x)

Keywords :   Protein-Dna Complex, Cyclin-Like Fold, Helix-Turn-Helix, Tata-Box, Transcription/Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   F. T. Tsai, P. B. Sigler
Structural Basis Of Preinitiation Complex Assembly On Human Pol Ii Promoters.
Embo J. V. 19 25 2000
PubMed-ID: 10619841 | Reference-DOI: 10.1093/EMBOJ/19.1.25
(for further references see the PDB file header)

Molecule 1 - ADMLP TATA-BOX DNA CONTAINING IIB RECOGNITION ELEMENT
	Chains	:	C, G, K, O, S
	Engineered	:	YES
	Other Details	:	NATURAL SEQUENCE OF ADENOVIRAL MAJOR LATE PROMOTER
	Synthetic	:	YES

Molecule 2 - ADMLP TATA-BOX DNA CONTAINING IIB RECOGNITION ELEMENT
	Chains	:	D, H, L, P, T
	Engineered	:	YES
	Other Details	:	NATURAL SEQUENCE OF ADENOVIRAL MAJOR LATE PROMOTER
	Synthetic	:	YES

Molecule 3 - GENERAL TRANSCRIPTION FACTOR IIB
	Chains	:	A, E, I, M, Q
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET21D
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	C-TERMINAL CORE DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TRANSCRIPTION INITIATION FACTOR IIB, TFIIBC

Molecule 4 - TATA BOX BINDING PROTEIN
	Chains	:	B, F, J, N, R
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET21D
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	C-TERMINAL CORE DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	TATA-BOX FACTOR, TATA SEQUENCE-BINDING PROTEIN, TBPC

		1	2	3	4	5	6	7	8	9	10	11	12	13	14	15	16	17	18	19	20
Asymmetric Unit	:	A	B	C	D	E	F	G	H	I	J	K	L	M	N	O	P	Q	R	S	T
Biological Unit 1 (1x)	:	A	B	C	D
Biological Unit 2 (1x)	:					E	F	G	H
Biological Unit 3 (1x)	:									I	J	K	L
Biological Unit 4 (1x)	:													M	N	O	P
Biological Unit 5 (1x)	:																	Q	R	S	T

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1C9B)

(no "Site" information available for 1C9B)

(no "SS Bond" information available for 1C9B)

Asymmetric Unit

No.	Residues
1	Glu B:206	-	Pro B:207
2	Lys B:297	-	Pro B:298
3	Glu F:206	-	Pro F:207
4	Lys F:297	-	Pro F:298
5	Glu J:206	-	Pro J:207
6	Lys J:297	-	Pro J:298
7	Glu N:206	-	Pro N:207
8	Lys N:297	-	Pro N:298
9	Glu R:206	-	Pro R:207
10	Lys R:297	-	Pro R:298

Asymmetric Unit (1, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035722	R	132	Q	TF2B_HUMAN	Unclassified	144944840	A/E/I/M/Q	R	132	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035722	R	132	Q	TF2B_HUMAN	Unclassified	144944840	A	R	132	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035722	R	132	Q	TF2B_HUMAN	Unclassified	144944840	E	R	132	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035722	R	132	Q	TF2B_HUMAN	Unclassified	144944840	I	R	132	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035722	R	132	Q	TF2B_HUMAN	Unclassified	144944840	M	R	132	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_035722	R	132	Q	TF2B_HUMAN	Unclassified	144944840	Q	R	132	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 20)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TFIIB	PS00782	Transcription factor TFIIB repeat signature.	TF2B_HUMAN	153-168 247-262	10	A:153-168 E:153-168 I:153-168 M:153-168 Q:153-168 A:247-262 E:247-262 I:247-262 M:247-262 Q:247-262
2	TFIID	PS00351	Transcription factor TFIID repeat signature.	TBP_HUMAN	192-241 283-332	10	B:192-241 F:192-241 J:192-241 N:192-241 R:192-241 B:283-332 F:283-332 J:283-332 N:283-332 R:283-332

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TFIIB	PS00782	Transcription factor TFIIB repeat signature.	TF2B_HUMAN	153-168 247-262	2	A:153-168 - - - - A:247-262 - - - -
2	TFIID	PS00351	Transcription factor TFIID repeat signature.	TBP_HUMAN	192-241 283-332	2	B:192-241 - - - - B:283-332 - - - -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TFIIB	PS00782	Transcription factor TFIIB repeat signature.	TF2B_HUMAN	153-168 247-262	2	- E:153-168 - - - - E:247-262 - - -
2	TFIID	PS00351	Transcription factor TFIID repeat signature.	TBP_HUMAN	192-241 283-332	2	- F:192-241 - - - - F:283-332 - - -

Biological Unit 3 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TFIIB	PS00782	Transcription factor TFIIB repeat signature.	TF2B_HUMAN	153-168 247-262	2	- - I:153-168 - - - - I:247-262 - -
2	TFIID	PS00351	Transcription factor TFIID repeat signature.	TBP_HUMAN	192-241 283-332	2	- - J:192-241 - - - - J:283-332 - -

Biological Unit 4 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TFIIB	PS00782	Transcription factor TFIIB repeat signature.	TF2B_HUMAN	153-168 247-262	2	- - - M:153-168 - - - - M:247-262 -
2	TFIID	PS00351	Transcription factor TFIID repeat signature.	TBP_HUMAN	192-241 283-332	2	- - - N:192-241 - - - - N:283-332 -

Biological Unit 5 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TFIIB	PS00782	Transcription factor TFIIB repeat signature.	TF2B_HUMAN	153-168 247-262	2	- - - - Q:153-168 - - - - Q:247-262
2	TFIID	PS00351	Transcription factor TFIID repeat signature.	TBP_HUMAN	192-241 283-332	2	- - - - R:192-241 - - - - R:283-332

Asymmetric Unit (10, 50)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000370500	1c	ENSE00001452875	chr1:89357301-89357166	136	TF2B_HUMAN	1-6	6	0	-	-
1.3b	ENST00000370500	3b	ENSE00001158820	chr1:89353050-89352944	107	TF2B_HUMAN	6-42	37	0	-	-
1.4c	ENST00000370500	4c	ENSE00000932079	chr1:89329797-89329664	134	TF2B_HUMAN	42-86	45	0	-	-
1.5a	ENST00000370500	5a	ENSE00000932078	chr1:89325969-89325823	147	TF2B_HUMAN	87-135	49	5	A:110-135 E:110-135 I:110-135 M:110-135 Q:110-135	26 26 26 26 26
1.6	ENST00000370500	6	ENSE00000932077	chr1:89325694-89325565	130	TF2B_HUMAN	136-179	44	5	A:136-179 E:136-179 I:136-179 M:136-179 Q:136-179	44 44 44 44 44
1.8d	ENST00000370500	8d	ENSE00000932076	chr1:89323170-89322889	282	TF2B_HUMAN	179-273	95	5	A:179-273 E:179-273 I:179-273 M:179-273 Q:179-273	95 95 95 95 95
1.9b	ENST00000370500	9b	ENSE00001158811	chr1:89319029-89318615	415	TF2B_HUMAN	273-316	44	5	A:273-316 E:273-316 I:273-316 M:273-316 Q:273-316	44 44 44 44 44

2.1b	ENST00000392092	1b	ENSE00001510680	chr6:170863459-170863551	93	TBP_HUMAN	-	0	0	-	-
2.3b	ENST00000392092	3b	ENSE00001510679	chr6:170865970-170866171	202	TBP_HUMAN	1-18	18	0	-	-
2.4c	ENST00000392092	4c	ENSE00000854357	chr6:170870879-170871321	443	TBP_HUMAN	19-166	148	5	B:158-166 F:158-166 J:158-166 N:158-166 R:158-166	9 9 9 9 9
2.5	ENST00000392092	5	ENSE00000766152	chr6:170873633-170873720	88	TBP_HUMAN	166-195	30	5	B:166-195 F:166-195 J:166-195 N:166-195 R:166-195	30 30 30 30 30
2.6b	ENST00000392092	6b	ENSE00000766154	chr6:170876006-170876097	92	TBP_HUMAN	196-226	31	5	B:196-226 F:196-226 J:196-226 N:196-226 R:196-226	31 31 31 31 31
2.7b	ENST00000392092	7b	ENSE00001593404	chr6:170878700-170878867	168	TBP_HUMAN	226-282	57	5	B:226-282 F:226-282 J:226-282 N:226-282 R:226-282	57 57 57 57 57
2.8	ENST00000392092	8	ENSE00001773146	chr6:170880498-170880592	95	TBP_HUMAN	282-314	33	5	B:282-314 F:282-314 J:282-314 N:282-314 R:282-314	33 33 33 33 33
2.9b	ENST00000392092	9b	ENSE00001510678	chr6:170881274-170881944	671	TBP_HUMAN	314-339	26	5	B:314-337 F:314-337 J:314-337 N:314-337 R:314-337	24 24 24 24 24

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:207
 aligned with TF2B_HUMAN | Q00403 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:207
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       
           TF2B_HUMAN   110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
               SCOP domains d1c9ba1 A:110-207 Transcription factor IIB (TFIIB), core domain                                   d1c9ba2 A:208-316 Transcription factor IIB (TFIIB), core domain                                               SCOP domains
               CATH domains ---1c9bA01 A:113-209  [code=1.10.472.10, no name defined]                                           1c9bA02 A:210-315  [code=1.10.472.10, no name defined]                                                    - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhhhh...hhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhhhhhh.hhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------------------Q---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------TFIIB           ------------------------------------------------------------------------------TFIIB           ------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: A:110-135 Exon 1.6  PDB: A:136-179 UniProt: 136-179   ---------------------------------------------------------------------------------------------Exon 1.9b  PDB: A:273-316 UniProt: 273-316   Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.8d  PDB: A:179-273 UniProt: 179-273                                                     ------------------------------------------- Transcript 1 (2)
                 1c9b A 110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309

Chain B from PDB  Type:PROTEIN  Length:180
 aligned with TBP_HUMAN | P20226 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:180
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337
            TBP_HUMAN   158 SSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
               SCOP domains d1c9bb1 B:158-252 TATA-box binding protein (TBP), C-terminal domain                            d1c9bb2 B:253-337 TATA-box binding protein (TBP), C-terminal domain                   SCOP domains
               CATH domains -1c9bB01    1c9bB02 B:170-255 TATA-Binding Protein                                                1c9bB01 B:159-169,B:256-337 TATA-Binding Protein                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeeeeeeee.....hhhhhhhhh............eee.......eeee....eeeeeee.hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeee.....hhhhhhhhhh............eeeee....eeeee....eeeeeee.hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------TFIID  PDB: B:192-241 UniProt: 192-241            -----------------------------------------TFIID  PDB: B:283-332 UniProt: 283-332            ----- PROSITE
           Transcript 2 (1) Exon 2.4c-----------------------------Exon 2.6b  PDB: B:196-226      -------------------------------------------------------Exon 2.8  PDB: B:282-314         ----------------------- Transcript 2 (1)
           Transcript 2 (2) --------Exon 2.5  PDB: B:166-195      ------------------------------Exon 2.7b  PDB: B:226-282 UniProt: 226-282               -------------------------------Exon 2.9b  PDB: B:314-33 Transcript 2 (2)
                 1c9b B 158 GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337

Chain C from PDB  Type:DNA  Length:18
                                                  
                 1c9b C   1 GGGCGCCTATAAAAGGGG  18
                                    10

Chain D from PDB  Type:DNA  Length:18
                                                  
                 1c9b D 101 CCCCCTTTTATAGGCGCC 118
                                   110

Chain E from PDB  Type:PROTEIN  Length:207
 aligned with TF2B_HUMAN | Q00403 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:207
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       
           TF2B_HUMAN   110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
               SCOP domains d1c9be1 E:110-207 Transcription factor IIB (TFIIB), core domain                                   d1c9be2 E:208-316 Transcription factor IIB (TFIIB), core domain                                               SCOP domains
               CATH domains ---1c9bE01 E:113-209  [code=1.10.472.10, no name defined]                                           1c9bE02 E:210-315  [code=1.10.472.10, no name defined]                                                    - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhhhh...hhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhhhhhh.hhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------------------Q---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------TFIIB           ------------------------------------------------------------------------------TFIIB           ------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: E:110-135 Exon 1.6  PDB: E:136-179 UniProt: 136-179   ---------------------------------------------------------------------------------------------Exon 1.9b  PDB: E:273-316 UniProt: 273-316   Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.8d  PDB: E:179-273 UniProt: 179-273                                                     ------------------------------------------- Transcript 1 (2)
                 1c9b E 110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309

Chain F from PDB  Type:PROTEIN  Length:180
 aligned with TBP_HUMAN | P20226 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:180
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337
            TBP_HUMAN   158 SSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
               SCOP domains d1c9bf1 F:158-252 TATA-box binding protein (TBP), C-terminal domain                            d1c9bf2 F:253-337 TATA-box binding protein (TBP), C-terminal domain                   SCOP domains
               CATH domains -1c9bF01    1c9bF02 F:170-255 TATA-Binding Protein                                                1c9bF01 F:159-169,F:256-337 TATA-Binding Protein                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeeeeeeee.....hhhhhhhhh............eee.......eeee....eeeeeee.hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeee.....hhhhhhhhhh............eeee......eeee....eeeeeee.hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------TFIID  PDB: F:192-241 UniProt: 192-241            -----------------------------------------TFIID  PDB: F:283-332 UniProt: 283-332            ----- PROSITE
           Transcript 2 (1) Exon 2.4c-----------------------------Exon 2.6b  PDB: F:196-226      -------------------------------------------------------Exon 2.8  PDB: F:282-314         ----------------------- Transcript 2 (1)
           Transcript 2 (2) --------Exon 2.5  PDB: F:166-195      ------------------------------Exon 2.7b  PDB: F:226-282 UniProt: 226-282               -------------------------------Exon 2.9b  PDB: F:314-33 Transcript 2 (2)
                 1c9b F 158 GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337

Chain G from PDB  Type:DNA  Length:18
                                                  
                 1c9b G   1 GGGCGCCTATAAAAGGGG  18
                                    10

Chain H from PDB  Type:DNA  Length:18
                                                  
                 1c9b H 101 CCCCCTTTTATAGGCGCC 118
                                   110

Chain I from PDB  Type:PROTEIN  Length:207
 aligned with TF2B_HUMAN | Q00403 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:207
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       
           TF2B_HUMAN   110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
               SCOP domains d1c9bi1 I:110-207 Transcription factor IIB (TFIIB), core domain                                   d1c9bi2 I:208-316 Transcription factor IIB (TFIIB), core domain                                               SCOP domains
               CATH domains ---1c9bI01 I:113-209  [code=1.10.472.10, no name defined]                                           1c9bI02 I:210-315  [code=1.10.472.10, no name defined]                                                    - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhhhh...hhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh....hhhhhhhhhh.hhhhhhhhhhhhh.hhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------------------Q---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------TFIIB           ------------------------------------------------------------------------------TFIIB           ------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: I:110-135 Exon 1.6  PDB: I:136-179 UniProt: 136-179   ---------------------------------------------------------------------------------------------Exon 1.9b  PDB: I:273-316 UniProt: 273-316   Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.8d  PDB: I:179-273 UniProt: 179-273                                                     ------------------------------------------- Transcript 1 (2)
                 1c9b I 110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309

Chain J from PDB  Type:PROTEIN  Length:180
 aligned with TBP_HUMAN | P20226 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:180
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337
            TBP_HUMAN   158 SSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
               SCOP domains d1c9bj1 J:158-252 TATA-box binding protein (TBP), C-terminal domain                            d1c9bj2 J:253-337 TATA-box binding protein (TBP), C-terminal domain                   SCOP domains
               CATH domains -1c9bJ01    1c9bJ02 J:170-255 TATA-Binding Protein                                                1c9bJ01 J:159-169,J:256-337 TATA-Binding Protein                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeeeeeeee.....hhhhhhhhh............eee.......eeee....eeeeeee.hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeee.....hhhhhhhhhh..ee........eeeee....eeeee....eeeeeee.hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------TFIID  PDB: J:192-241 UniProt: 192-241            -----------------------------------------TFIID  PDB: J:283-332 UniProt: 283-332            ----- PROSITE
           Transcript 2 (1) Exon 2.4c-----------------------------Exon 2.6b  PDB: J:196-226      -------------------------------------------------------Exon 2.8  PDB: J:282-314         ----------------------- Transcript 2 (1)
           Transcript 2 (2) --------Exon 2.5  PDB: J:166-195      ------------------------------Exon 2.7b  PDB: J:226-282 UniProt: 226-282               -------------------------------Exon 2.9b  PDB: J:314-33 Transcript 2 (2)
                 1c9b J 158 GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337

Chain K from PDB  Type:DNA  Length:18
                                                  
                 1c9b K   1 GGGCGCCTATAAAAGGGG  18
                                    10

Chain L from PDB  Type:DNA  Length:18
                                                  
                 1c9b L 101 CCCCCTTTTATAGGCGCC 118
                                   110

Chain M from PDB  Type:PROTEIN  Length:207
 aligned with TF2B_HUMAN | Q00403 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:207
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       
           TF2B_HUMAN   110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
               SCOP domains d1c9bm1 M:110-207 Transcription factor IIB (TFIIB), core domain                                   d1c9bm2 M:208-316 Transcription factor IIB (TFIIB), core domain                                               SCOP domains
               CATH domains ---1c9bM01 M:113-209  [code=1.10.472.10, no name defined]                                           1c9bM02 M:210-315  [code=1.10.472.10, no name defined]                                                    - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhhhh...hhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhhhhhh.hhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------------------Q---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------TFIIB           ------------------------------------------------------------------------------TFIIB           ------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: M:110-135 Exon 1.6  PDB: M:136-179 UniProt: 136-179   ---------------------------------------------------------------------------------------------Exon 1.9b  PDB: M:273-316 UniProt: 273-316   Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.8d  PDB: M:179-273 UniProt: 179-273                                                     ------------------------------------------- Transcript 1 (2)
                 1c9b M 110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309

Chain N from PDB  Type:PROTEIN  Length:180
 aligned with TBP_HUMAN | P20226 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:180
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337
            TBP_HUMAN   158 SSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
               SCOP domains d1c9bn1 N:158-252 TATA-box binding protein (TBP), C-terminal domain                            d1c9bn2 N:253-337 TATA-box binding protein (TBP), C-terminal domain                   SCOP domains
               CATH domains -1c9bN01    1c9bN02 N:170-255 TATA-Binding Protein                                                1c9bN01 N:159-169,N:256-337 TATA-Binding Protein                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeeeeeeee.....hhhhhhhhh............eee.......eeee....eeeeeee.hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeee.....hhhhhhhhhh............eeeee....eeeee....eeeeeee.hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------TFIID  PDB: N:192-241 UniProt: 192-241            -----------------------------------------TFIID  PDB: N:283-332 UniProt: 283-332            ----- PROSITE
           Transcript 2 (1) Exon 2.4c-----------------------------Exon 2.6b  PDB: N:196-226      -------------------------------------------------------Exon 2.8  PDB: N:282-314         ----------------------- Transcript 2 (1)
           Transcript 2 (2) --------Exon 2.5  PDB: N:166-195      ------------------------------Exon 2.7b  PDB: N:226-282 UniProt: 226-282               -------------------------------Exon 2.9b  PDB: N:314-33 Transcript 2 (2)
                 1c9b N 158 GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337

Chain O from PDB  Type:DNA  Length:18
                                                  
                 1c9b O   1 GGGCGCCTATAAAAGGGG  18
                                    10

Chain P from PDB  Type:DNA  Length:18
                                                  
                 1c9b P 101 CCCCCTTTTATAGGCGCC 118
                                   110

Chain Q from PDB  Type:PROTEIN  Length:207
 aligned with TF2B_HUMAN | Q00403 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:207
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       
           TF2B_HUMAN   110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
               SCOP domains d1c9bq1 Q:110-207 Transcription factor IIB (TFIIB), core domain                                   d1c9bq2 Q:208-316 Transcription factor IIB (TFIIB), core domain                                               SCOP domains
               CATH domains ---1c9bQ01 Q:113-209  [code=1.10.472.10, no name defined]                                           1c9bQ02 Q:210-315  [code=1.10.472.10, no name defined]                                                    - CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh....hhhhhhhh...hhhhhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhh.....hhhhhhhhhh.hhhhhhhhhhhhh.hhhhhh................ Sec.struct. author
                 SAPs(SNPs) ----------------------Q---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------TFIIB           ------------------------------------------------------------------------------TFIIB           ------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: Q:110-135 Exon 1.6  PDB: Q:136-179 UniProt: 136-179   ---------------------------------------------------------------------------------------------Exon 1.9b  PDB: Q:273-316 UniProt: 273-316   Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.8d  PDB: Q:179-273 UniProt: 179-273                                                     ------------------------------------------- Transcript 1 (2)
                 1c9b Q 110 SDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL 316
                                   119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309

Chain R from PDB  Type:PROTEIN  Length:180
 aligned with TBP_HUMAN | P20226 from UniProtKB/Swiss-Prot  Length:339

    Alignment length:180
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337
            TBP_HUMAN   158 SSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
               SCOP domains d1c9br1 R:158-252 TATA-box binding protein (TBP), C-terminal domain                            d1c9br2 R:253-337 TATA-box binding protein (TBP), C-terminal domain                   SCOP domains
               CATH domains -1c9bR01    1c9bR02 R:170-255 TATA-Binding Protein                                                1c9bR01 R:159-169,R:256-337 TATA-Binding Protein                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......eeeeeeeeee.....hhhhhhhhh............eee.......eeee....eeeeeee.hhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeee.....hhhhhhhhhh..ee........eeeee....eeeee....eeeeeee.hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------TFIID  PDB: R:192-241 UniProt: 192-241            -----------------------------------------TFIID  PDB: R:283-332 UniProt: 283-332            ----- PROSITE
           Transcript 2 (1) Exon 2.4c-----------------------------Exon 2.6b  PDB: R:196-226      -------------------------------------------------------Exon 2.8  PDB: R:282-314         ----------------------- Transcript 2 (1)
           Transcript 2 (2) --------Exon 2.5  PDB: R:166-195      ------------------------------Exon 2.7b  PDB: R:226-282 UniProt: 226-282               -------------------------------Exon 2.9b  PDB: R:314-33 Transcript 2 (2)
                 1c9b R 158 GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK 337
                                   167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337

Chain S from PDB  Type:DNA  Length:18
                                                  
                 1c9b S   1 GGGCGCCTATAAAAGGGG  18
                                    10

Chain T from PDB  Type:DNA  Length:18
                                                  
                 1c9b T 101 CCCCCTTTTATAGGCGCC 118
                                   110

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Cyclin-like (137)

Superfamily: Cyclin-like (137)

Family: Transcription factor IIB (TFIIB), core domain (6)

Protein domain: Transcription factor IIB (TFIIB), core domain (6)

Human (Homo sapiens) [TaxId: 9606] (4)

1a	d1c9ba1	A:110-207
1b	d1c9bq1	Q:110-207
1c	d1c9bq2	Q:208-316
1d	d1c9ba2	A:208-316
1e	d1c9be1	E:110-207
1f	d1c9be2	E:208-316
1g	d1c9bi1	I:110-207
1h	d1c9bi2	I:208-316
1i	d1c9bm1	M:110-207
1j	d1c9bm2	M:208-316

Class: Alpha and beta proteins (a+b) (23004)

Fold: TBP-like (289)

Superfamily: TATA-box binding protein-like (70)

Family: TATA-box binding protein (TBP), C-terminal domain (29)

Protein domain: TATA-box binding protein (TBP), C-terminal domain (29)

Human (Homo sapiens) [TaxId: 9606] (5)

2a	d1c9bb1	B:158-252
2b	d1c9bj1	J:158-252
2c	d1c9bj2	J:253-337
2d	d1c9bn1	N:158-252
2e	d1c9bn2	N:253-337
2f	d1c9br1	R:158-252
2g	d1c9br2	R:253-337
2h	d1c9bb2	B:253-337
2i	d1c9bf1	F:158-252
2j	d1c9bf2	F:253-337

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: TATA-Binding Protein (118)

Homologous Superfamily: TATA-Binding Protein (37)

[unclassified] (13)

1a	1c9bB01	B:159-169,B:256-337
1b	1c9bF01	F:159-169,F:256-337
1c	1c9bJ01	J:159-169,J:256-337
1d	1c9bN01	N:159-169,N:256-337
1e	1c9bR01	R:159-169,R:256-337
1f	1c9bB02	B:170-255
1g	1c9bF02	F:170-255
1h	1c9bJ02	J:170-255
1i	1c9bN02	N:170-255
1j	1c9bR02	R:170-255

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Cyclin A; domain 1 (136)

Homologous Superfamily: [code=1.10.472.10, no name defined] (99)

[unclassified] (5)

2a	1c9bA02	A:210-315
2b	1c9bI02	I:210-315
2c	1c9bM02	M:210-315
2d	1c9bQ02	Q:210-315
2e	1c9bA01	A:113-209
2f	1c9bE01	E:113-209
2g	1c9bI01	I:113-209
2h	1c9bM01	M:113-209
2i	1c9bQ01	Q:113-209
2j	1c9bE02	E:210-315

(no "Pfam Domain" information available for 1C9B)

Asymmetric Unit(hide GO term definitions)

Chain A,E,I,M,Q (TF2B_HUMAN | Q00403)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0017025	TBP-class protein binding	Interacting selectively and non-covalently with a member of the class of TATA-binding proteins (TBP), including any of the TBP-related factors (TRFs).
	GO:0001047	core promoter binding	Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for the basal transcription machinery. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046966	thyroid hormone receptor binding	Interacting selectively and non-covalently with a thyroid hormone receptor.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0006352	DNA-templated transcription, initiation	Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0042795	snRNA transcription by RNA polymerase II	The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
	GO:0006366	transcription by RNA polymerase II	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006367	transcription initiation from RNA polymerase II promoter	Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,F,J,N,R (TBP_HUMAN | P20226)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003700	DNA-binding transcription factor activity	A protein or a member of a complex that interacts selectively and non-covalently with a specific DNA sequence (sometimes referred to as a motif) within the regulatory region of a gene to modulate transcription. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
	GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	Interacting selectively and non-covalently with a DNA sequence that is part of the core promoter of a RNA polymerase II-transcribed gene.
	GO:0000978	RNA polymerase II proximal promoter sequence-specific DNA binding	Interacting selectively and non-covalently with a specific upstream regulatory DNA sequence (transcription factor recognition sequence or binding site) located in the proximal promoter of a gene transcribed by RNA polymerase II. The proximal promoter is in cis with and relatively close to the core promoter.
	GO:0001103	RNA polymerase II repressing transcription factor binding	Interacting selectively and non-covalently with an RNA polymerase II transcription repressing factor, a protein involved in negative regulation of transcription.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0070491	repressing transcription factor binding	Interacting selectively and non-covalently with a transcription repressor, any protein whose activity is required to prevent or downregulate transcription.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
biological process
	GO:0006352	DNA-templated transcription, initiation	Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
	GO:0045815	positive regulation of gene expression, epigenetic	Any epigenetic process that activates or increases the rate of gene expression.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:1901796	regulation of signal transduction by p53 class mediator	Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0042795	snRNA transcription by RNA polymerase II	The synthesis of small nuclear RNA (snRNA) from a DNA template by RNA Polymerase II (Pol II), originating at a Pol II promoter.
	GO:0007283	spermatogenesis	The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
	GO:0006363	termination of RNA polymerase I transcription	The process in which the synthesis of an RNA molecule by RNA polymerase I using a DNA template is completed. RNAP I termination requires binding of a terminator protein so specific sequences downstream of the transcription unit.
	GO:0006366	transcription by RNA polymerase II	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006383	transcription by RNA polymerase III	The synthesis of RNA from a DNA template by RNA polymerase III, originating at an RNAP III promoter.
	GO:0006362	transcription elongation from RNA polymerase I promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase I specific promoter by the addition of ribonucleotides catalyzed by RNA polymerase I.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006361	transcription initiation from RNA polymerase I promoter	Any process involved in the assembly of the RNA polymerase I preinitiation complex (PIC) at an RNA polymerase I promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006367	transcription initiation from RNA polymerase II promoter	Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0001939	female pronucleus	The pronucleus originating from the ovum that is being fertilized.
	GO:0001940	male pronucleus	The pronucleus originating from the spermatozoa that was involved in fertilization.
	GO:0005719	nuclear euchromatin	The dispersed less dense form of chromatin in the interphase nucleus. It exists in at least two forms, a some being in the form of transcriptionally active chromatin which is the least condensed, while the rest is inactive euchromatin which is more condensed than active chromatin but less condensed than heterochromatin.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0045120	pronucleus	The nucleus of either the ovum or the spermatozoon following fertilization. Thus, in the fertilized ovum, there are two pronuclei, one originating from the ovum, the other from the spermatozoon that brought about fertilization; they approach each other, but do not fuse until just before the first cleavage, when each pronucleus loses its membrane to release its contents.
	GO:0005672	transcription factor TFIIA complex	A component of the transcription machinery of RNA Polymerase II. In humans, TFIIA is a heterotrimer composed of an alpha (P35), beta (P19) and gamma subunits (P12).
	GO:0005669	transcription factor TFIID complex	A complex composed of TATA binding protein (TBP) and TBP associated factors (TAFs); the total mass is typically about 800 kDa. Most of the TAFs are conserved across species. In TATA-containing promoters for RNA polymerase II (Pol II), TFIID is believed to recognize at least two distinct elements, the TATA element and a downstream promoter element. TFIID is also involved in recognition of TATA-less Pol II promoters. Binding of TFIID to DNA is necessary but not sufficient for transcription initiation from most RNA polymerase II promoters.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1c9b)

	Sites
(no "Sites" information available for 1c9b)

	Cis Peptide Bonds
		Glu B:206 - Pro B:207	[ RasMol ]
		Glu F:206 - Pro F:207	[ RasMol ]
		Glu J:206 - Pro J:207	[ RasMol ]
		Glu N:206 - Pro N:207	[ RasMol ]
		Glu R:206 - Pro R:207	[ RasMol ]
		Lys B:297 - Pro B:298	[ RasMol ]
		Lys F:297 - Pro F:298	[ RasMol ]
		Lys J:297 - Pro J:298	[ RasMol ]
		Lys N:297 - Pro N:298	[ RasMol ]
		Lys R:297 - Pro R:298	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1c9b
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TBP_HUMAN \| P20226
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TF2B_HUMAN \| Q00403
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	0067
		Age Related Information	:	GenAge
	0194
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TBP_HUMAN \| P20226
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TF2B_HUMAN \| Q00403
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1ais	CRYSTAL STRUCTURE OF AN ARCHAEAL TBP-TF(II)BC-DNA COMPLEX.
1tfb	NMR STRUCTURE OF HUMAN TFIIBC ALONE.
1vol	CRYSTAL STRUCTURE CONSISTING OF A. THALIANA TBP2 AND HUMAN TFIIBC BOUND TO A PROMOTER ELEMENT.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (10, 10)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 5)

PROSITE Motifs (2, 20)

Exons (10, 50)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 20)

CATH Domains (2, 20)

Pfam Domains (0, 0)

Gene Ontology (41, 54)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File