Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CHROMOSOMAL DNA-BINDING PROTEIN SSO7D/D(GCGAACGC) COMPLEX
 
Authors :  S. Su, Y. -G. Gao, H. Robinson, S. Padmanabhan, L. Lim, J. W. Shriver, A. H. -J. Wang
Date :  27 May 98  (Deposition) - 10 Nov 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Dna Binding Protein, Hyperthermophile, Archaebacteria, Complex (Dna-Binding Protein/Dna) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. G. Gao, S. Y. Su, H. Robinson, S. Padmanabhan, L. Lim, B. S. Mccrary, S. P. Edmondson, J. W. Shriver, A. H. Wang
The Crystal Structure Of The Hyperthermophile Chromosomal Protein Sso7D Bound To Dna.
Nat. Struct. Biol. V. 5 782 1998
PubMed-ID: 9731772  |  Reference-DOI: 10.1038/1822
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA (5'-D(*GP*CP*GP*TP*5IUP*CP*GP*C)-3')
    Chains: B
    Engineered: YES
    Synthetic: YES
 
Molecule 2 - DNA (5'-D(*GP*CP*GP*AP*AP*CP*GP*C)-3')
    Chains: C
    Engineered: YES
    Synthetic: YES
 
Molecule 3 - PROTEIN (CHROMOSOMAL PROTEIN SSO7D)
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: SULFOLOBUS ACIDOCALDARIUS
    Organism Taxid: 2285
    Synonym: DNA-BINDING PROTEIN 7D, 7 KD DNA-BINDING PROTEIN D, SSO7D

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
15IU1Mod. Nucleotide5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE

(-) Sites  (0, 0)

(no "Site" information available for 1BF4)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BF4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1BF4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BF4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1BF4)

(-) Exons   (0, 0)

(no "Exon" information available for 1BF4)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:63
 aligned with DN7D_SULAC | P13123 from UniProtKB/Swiss-Prot  Length:66

    Alignment length:66
                                                                 39                           
                                                               38 |                           
                                    11        21        31      | 40        50        60      
           DN7D_SULAC     2 VKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNG-KTGRGAVSEKDAPKELLDMLARAEREKK  66
               SCOP domains d1bf4a_ A: DNA-binding protein                                     SCOP domains
               CATH domains 1bf4A00 A:2-64  [code=2.40.50.40, no name defined]                 CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..eeeeeehhheeeeeee..eeeeeee.hhh.eeeeeee.....hhhhhhh---hh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------ Transcript
                 1bf4 A   2 ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQML---EKQKK  64
                                    11        21        31        41        51       | - |    
                                                                                    59  60    


Chain B from PDB  Type:DNA  Length:8
                                        
                 1bf4 B 101 GCGTuCGC 108
                                |   
                              105-5IU


Chain C from PDB  Type:DNA  Length:8
                                        
                 1bf4 C 109 GCGAACGC 116
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BF4)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (DN7D_SULAC | P13123)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0004521    endoribonuclease activity    Catalysis of the hydrolysis of ester linkages within ribonucleic acid by creating internal breaks.
biological process
    GO:0090502    RNA phosphodiester bond hydrolysis, endonucleolytic    The chemical reactions and pathways involving the hydrolysis of internal 3',5'-phosphodiester bonds in one or two strands of ribonucleotides.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5IU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1bf4)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1bf4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bf4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DN7D_SULAC | P13123
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DN7D_SULAC | P13123
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DN7D_SULAC | P13123: 1azp 1azq 1ca5 1ca6 1sap 1wd0 1wd1 1wto 1wtp 1wtq 1wtr 1wtv 1wtw 1wtx 1wvl 1xx8 1xyi 2xiw 4cj1 4cj2

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BF4)