Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  DISCOVERY OF MLI-2, AN ORALLY AVAILABLE AND SELECTIVE LRRK2 INHIBITOR THAT REDUCES BRAIN KINASE ACTIVITY
 
Authors :  J. D. Scott, D. E. Demong, M. J. Fell, C. Mirescu, K. Basu, T. J. Greshock, J. A. Morrow, L. Xiao, A. Hruza, J. Harris, H. E. Tiscia, R. K. Chang, M. W J. A. Mccauley, W. Li, S. Lin, H. Liu, X. Dai, M. Baptista, G. Agnihotri, J. Columbus, H. Mei, M. Poirier, X. Zhou, Y. Lin, Z. Yin, J. M. Sanders, R. E. Drolet, J. T. Kern, M. E. Kennedy, E. M. Parker, A. W. Stamford, R. N M. W. Miller
Date :  08 Dec 16  (Deposition) - 15 Mar 17  (Release) - 26 Apr 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.69
Chains :  Asym./Biol. Unit :  A
Keywords :  Mli-2, Lrrk2, Kinase Inhibitor, Kinase Selectivity, Parkinson'S Disease, Transferase, Serine/ Threonine-Protein Kinase, Map Kinase, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. D. Scott, D. E. Demong, T. J. Greshock, K. Basu, X. Dai, J. Harris, A. Hruza, S. W. Li, S. I. Lin, H. Liu, M. K. Macala, Z. Hu, H. Mei, H. Zhang, P. Walsh, M. Poirier, Z. C. Shi, L. Xiao, G. Agnihotri, M. A. Baptista, J. Columbus, M. J. Fell, L. A. Hyde, R. Kuvelkar, Y. Lin, C. Mirescu, J. A. Morrow, Z. Yin, X. Zhang, X. Zhou, R. K. Chang, M. W. Embrey, J. M. Sanders, H. E. Tiscia, R. E. Drolet, J. T. Kern, S. M. Sur, J. J. Renger, M. T. Bilodeau, M. E. Kennedy, E. M. Parker, A. W. Stamford R. Nargund, J. A. Mccauley, M. W. Miller
Discovery Of A 3-(4-Pyrimidinyl) Indazole (Mli-2), An Orall Available And Selective Leucine-Rich Repeat Kinase 2 (Lrrk2 Inhibitor That Reduces Brain Kinase Activity.
J. Med. Chem. V. 60 2983 2017
PubMed-ID: 28245354  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.7B00045

(-) Compounds

Molecule 1 - MITOGEN-ACTIVATED PROTEIN KINASE 1
    ChainsA
    EC Number2.7.11.24
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneMAPK1, ERK2, MAPK, PRKM1
    Organism CommonRAT
    Organism ScientificRATTUS NORVEGICUS
    Organism Taxid10116
    SynonymMAPK 1,ERT1,EXTRACELLULAR SIGNAL-REGULATED KINASE 2,ERK-2, MAP KINASE ISOFORM P42,P42-MAPK,MITOGEN-ACTIVATED PROTEIN KINASE 2, MAPK 2

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
181Y1Ligand/Ion3-[2-(MORPHOLIN-4-YL)PYRIDIN-4-YL]-5-[(PROPAN-2-YL)OXY]-1H-INDAZOLE
2SO44Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:50 , GLN A:103 , ASP A:104 , LEU A:105 , MET A:106 , GLU A:107 , THR A:108 , LYS A:112 , ASN A:152 , LEU A:154 , HOH A:635binding site for residue 81Y A 401
2AC2SOFTWAREARG A:68 , ARG A:170 , VAL A:171 , ASP A:330 , MET A:331 , HOH A:573 , HOH A:596binding site for residue SO4 A 402
3AC3SOFTWAREARG A:65 , ARG A:146 , ARG A:170 , VAL A:186 , TYR A:203 , HOH A:502 , HOH A:603binding site for residue SO4 A 403
4AC4SOFTWARETYR A:185 , ARG A:189 , ARG A:192 , TYR A:231 , HOH A:569 , HOH A:636 , HOH A:658binding site for residue SO4 A 404
5AC5SOFTWAREASP A:122 , GLY A:180 , LYS A:257 , HOH A:530 , HOH A:575 , HOH A:638 , HOH A:646 , HOH A:665binding site for residue SO4 A 405

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5U6I)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Gly A:20 -Pro A:21

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5U6I)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5U6I)

(-) Exons   (0, 0)

(no "Exon" information available for 5U6I)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:339
                                                                                                                                                                                                                                                                                                                                                                                   
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeee...eeeeeee....eeeeeeee....hhhhhhhhhhhhhhhhhh.........eee..........eeeeee...eehhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee.hhhhh..........hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh..hhhhhhh..hhhhhhhhhhh......hhhhhh...hhhhhhhhhhhh........hhhhhhhhhhhh...hhhhh................hhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5u6i A  16 VFDVGPRYTNLSYIGEGAGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG 355
                                    25       |36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346         
                                            33|                                                                                                                                                                                                                                                                                                                                
                                             35                                                                                                                                                                                                                                                                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5U6I)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5U6I)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5U6I)

(-) Gene Ontology  (89, 89)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    81Y  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:20 - Pro A:21   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5u6i
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MK01_RAT | P63086
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.11.24
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MK01_RAT | P63086
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MK01_RAT | P630861erk 1gol 2erk 2fys 2gph 2z7l 3c9w 3erk 3o71 3qyw 3qyz 3r63 3zu7 3zuv 4erk 4gsb 4gt3 4gva 4i5h 4n4s 4qyy 4s2z 4s30 4s31 4s32 4s33 4s34 4xne 4xoy 4xoz 4xp0 4xp2 4xp3 4xrj 4xrl 5hd4 5hd7 5ke0 5umo

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5U6I)