Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  PLP AND GABA TRIGGER GABR-MEDIATED TRANSCRIPTION REGULATION IN BACILLUS SUBSIDIES VIA EXTERNAL ALDIMINE FORMATION
 
Authors :  R. Wu, R. Sanishvili, B. R. Belitsky, J. I. Juncosa, H. V. Le, H. J. S. Lehr M. Farley, R. B. Silverman, G. A. Petsko, D. Ringe, D. Liu
Date :  29 Aug 16  (Deposition) - 29 Mar 17  (Release) - 19 Apr 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.53
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Gabr, Mocr, Plp, Gaba, External Aldimine, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Wu, R. Sanishvili, B. R. Belitsky, J. I. Juncosa, H. V. Le, H. J. Lehrer, M. Farley, R. B. Silverman, G. A. Petsko, D. Ringe, D. Liu
Plp And Gaba Trigger Gabr-Mediated Transcription Regulation In Bacillus Subtilis Via External Aldimine Formation.
Proc. Natl. Acad. Sci. V. 114 3891 2017 U. S. A.
PubMed-ID: 28348215  |  Reference-DOI: 10.1073/PNAS.1703019114

(-) Compounds

Molecule 1 - ASPARTATE AMINOTRANSFERASE
    ChainsA
    EC Number2.6.1.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymASPAT,TRANSAMINASE A

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
177E1Ligand/Ion(4R)-4-AMINO-6-{3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)METHYL]PYRIDIN-4-YL}HEXANOIC ACID
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
177E2Ligand/Ion(4R)-4-AMINO-6-{3-HYDROXY-2-METHYL-5-[(PHOSPHONOOXY)METHYL]PYRIDIN-4-YL}HEXANOIC ACID

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:34 , TYR A:65 , GLY A:102 , GLY A:103 , THR A:104 , TRP A:130 , ASN A:183 , ASP A:211 , TYR A:214 , SER A:243 , SER A:245 , LYS A:246 , ARG A:254 , ARG A:280 , HOH A:544 , HOH A:606 , HOH A:654 , HOH A:713binding site for residue 77E A 401

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5T4L)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Leu A:14 -Gly A:15
2Pro A:26 -Gly A:27
3Asn A:127 -Pro A:128
4Asn A:183 -Pro A:184

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5T4L)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5T4L)

(-) Exons   (0, 0)

(no "Exon" information available for 5T4L)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:396
                                                                                                                                                                                                                                                                                                                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhh.....ee...............hhhhhhhhhhhhhhh..........hhhhhhhhhhhhhh..hhhhhh..eeeeeehhhhhhhhhhhhhhhhhh...eeeeee...hhhhhhhhhh..eeeeee.ee....eehhhhhhhhhh......eeeee...........hhhhhhhhhhhhhhhh.eeeeee.......hhhhhhhhhhhhhhhh..eeeeee......hhhhh.eeeeee..hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhh...eee...hhhhhhhhhhhhhee.....eee.hhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5t4l A   1 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5T4L)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5T4L)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5T4L)

(-) Gene Ontology  (14, 14)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    77E  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:127 - Pro A:128   [ RasMol ]  
    Asn A:183 - Pro A:184   [ RasMol ]  
    Leu A:14 - Gly A:15   [ RasMol ]  
    Pro A:26 - Gly A:27   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5t4l
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AAT_ECOLI | P00509
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.6.1.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AAT_ECOLI | P00509
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AAT_ECOLI | P005091aam 1aaw 1ahe 1ahf 1ahg 1ahx 1ahy 1aia 1aib 1aic 1amq 1amr 1ams 1arg 1arh 1ari 1ars 1art 1asa 1asb 1asc 1asd 1ase 1asf 1asg 1asl 1asm 1asn 1b4x 1bqa 1bqd 1c9c 1cq6 1cq7 1cq8 1czc 1cze 1g4v 1g4x 1g7w 1g7x 1ix6 1ix7 1ix8 1qir 1qis 1qit 1spa 1toe 1tog 1toi 1toj 1tok 1x28 1x29 1x2a 1yoo 2aat 2d5y 2d61 2d63 2d64 2d65 2d66 2d7y 2d7z 2q7w 2qa3 2qb2 2qb3 2qbt 3aat 3qn6 3qpg 3zzj 3zzk 4a00 4dbc 4f5f 4f5g 4f5h 4f5i 4f5j 4f5k 4f5l 4f5m 5eaa

(-) Related Entries Specified in the PDB File

5t4k