Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ASPARTATE AMINOTRANSFERASE P138A/P195A DOUBLE MUTANT
 
Authors :  V. N. Malashkevich, J. N. Jansonius
Date :  14 Aug 98  (Deposition) - 11 May 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transferase, Aminotransferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Birolo, V. N. Malashkevich, G. Capitani, F. De Luca, A. Moretta, J. N. Jansonius, G. Marino
Functional And Structural Analysis Of Cis-Proline Mutants Of Escherichia Coli Aspartate Aminotransferase.
Biochemistry V. 38 905 1999
PubMed-ID: 9893985  |  Reference-DOI: 10.1021/BI981467D
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ASPARTATE AMINOTRANSFERASE
    Chains: A, B
    EC Number: 2.6.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PKDHE19
    Expression System Taxid: 562
    Mutation: YES
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Other Details: SCHIFF BASE BETWEEN LYS 258 AND COFACTOR, PYRIDOXAL-5'-PHOSPHATE (PLP)
    Strain: TY103
    Synonym: ASPARTATE TRANSAMINASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1LLP2Mod. Amino Acid2-LYSINE(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHANE)

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1ACTUNKNOWNASP A:15 , ILE A:17 , LEU A:18 , ILE A:37 , GLY A:38 , VAL A:39 , TYR B:70 , GLY A:107 , GLY A:108 , THR A:109 , TRP A:140 , ASN A:194 , ASP A:222 , ALA A:224 , TYR A:225 , SER A:255 , LLP A:258 , ARG A:266 , ARG B:292 , SER B:296 , ASN B:297 , PHE A:360 , ARG A:386ACTIVE SITE OF SUBUNIT A
2BCTUNKNOWNASP B:15 , ILE B:17 , LEU B:18 , ILE B:37 , GLY B:38 , VAL B:39 , TYR A:70 , GLY B:107 , GLY B:108 , THR B:109 , TRP B:140 , ASN B:194 , ASP B:222 , ALA B:224 , TYR B:225 , SER B:255 , LLP B:258 , ARG B:266 , ARG A:292 , SER A:296 , ASN A:297 , PHE B:360 , ARG B:386ACTIVE SITE OF SUBUNIT B

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1BQD)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Asn A:194 -Ala A:195
2Asn B:194 -Ala B:195

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1BQD)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1AA_TRANSFER_CLASS_1PS00105 Aminotransferases class-I pyridoxal-phosphate attachment site.AAT_ECOLI243-256
 
  2A:255-268
B:255-268

(-) Exons   (0, 0)

(no "Exon" information available for 1BQD)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:396
 aligned with AAT_ECOLI | P00509 from UniProtKB/Swiss-Prot  Length:396

    Alignment length:396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      
            AAT_ECOLI     1 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396
               SCOP domains d1bqda_ A: Aspartate aminotransferase, AAT                                                                                                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ----------1bqdA01 A:15-48,A:328-408         1bqdA02 A:49-327 Type I PLP-dependent aspartate aminotransferase-like (Major domain)                                                                                                                                                                                           1bqdA01 A:15-48,A:328-408 Aspartate Aminotransferase, domain 1                  - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhhhhh.........................hhhhhhhhhhhhh............hhhhhhhhhhhh....hhhh...eeeeeeehhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhh..eeeeee..........hhhhhhhhhh.....eeeee............hhhhhhhhhhhhhh..eeeeee..........hhhhhhhhhh.....eeeeee.......hhh.eeeeeee...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhh....eee....hhhhhhhhhhh........eeehhh.....hhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AA_TRANSFER_CL-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bqd A   5 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNASWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSkNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 409
                                    14        24        34        44        54        64|       75        85        95       105       115       125|||    140       150 ||    161       171       181       191       201       211       221       231|      242       252     | 262       272       282       292       302       312       322       332       342       352       362       372       382       392       402  ||  
                                                                                      64|                                                         126||                152|                                                                          231|                      258-LLP                                                                                                                                            405|  
                                                                                       66                                                          129|                 154                                                                           233                                                                                                                                                                          407  
                                                                                                                                                    133                                                                                                                                                                                                                                                                                 

Chain B from PDB  Type:PROTEIN  Length:396
 aligned with AAT_ECOLI | P00509 from UniProtKB/Swiss-Prot  Length:396

    Alignment length:396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      
            AAT_ECOLI     1 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396
               SCOP domains d1bqdb_ B: Aspartate aminotransferase, AAT                                                                                                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ----------1bqdB01 B:15-48,B:328-408         1bqdB02 B:49-327 Type I PLP-dependent aspartate aminotransferase-like (Major domain)                                                                                                                                                                                           1bqdB01 B:15-48,B:328-408 Aspartate Aminotransferase, domain 1                  - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhhhhh.........................hhhhhhhhhhhhh............hhhhhhhhhhhh....hhhh...eeeeeeehhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhh..eeeeee..........hhhhhhhhhh.....eeeee............hhhhhhhhhhhhhh..eeeeee..........hhhhhhhhhh.....eeeeee.......hhh.eeeeeee...hhhhhhhhhhhhhhhh.......hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhh....eee....hhhhhhhhhhh........eeehhh.....hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AA_TRANSFER_CL-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bqd B   5 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNASWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSkNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 409
                                    14        24        34        44        54        64|       75        85        95       105       115       125|||    140       150 ||    161       171       181       191       201       211       221       231|      242       252     | 262       272       282       292       302       312       322       332       342       352       362       372       382       392       402  ||  
                                                                                      64|                                                         126||                152|                                                                          231|                      258-LLP                                                                                                                                            405|  
                                                                                       66                                                          129|                 154                                                                           233                                                                                                                                                                          407  
                                                                                                                                                    133                                                                                                                                                                                                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1BQD)

(-) Gene Ontology  (14, 14)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (AAT_ECOLI | P00509)
molecular function
    GO:0004069    L-aspartate:2-oxoglutarate aminotransferase activity    Catalysis of the reaction: L-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate.
    GO:0080130    L-phenylalanine:2-oxoglutarate aminotransferase activity    Catalysis of the reaction: L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate.
    GO:0004838    L-tyrosine:2-oxoglutarate aminotransferase activity    Catalysis of the reaction: L-tyrosine + 2-oxoglutarate = 4-hydroxyphenylpyruvate + L-glutamate.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0030170    pyridoxal phosphate binding    Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
    GO:0008483    transaminase activity    Catalysis of the transfer of an amino group to an acceptor, usually a 2-oxo acid.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0009094    L-phenylalanine biosynthetic process    The chemical reactions and pathways resulting in the formation of L-phenylalanine, the L-enantiomer of 2-amino-3-phenylpropanoic acid, i.e. (2S)-2-amino-3-phenylpropanoic acid.
    GO:0033585    L-phenylalanine biosynthetic process from chorismate via phenylpyruvate    The chemical reactions and pathways resulting in the formation of L-phenylalanine from other compounds, including chorismate, via the intermediate phenylpyruvate.
    GO:0009058    biosynthetic process    The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
    GO:0006520    cellular amino acid metabolic process    The chemical reactions and pathways involving amino acids, carboxylic acids containing one or more amino groups, as carried out by individual cells.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    LLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    ACT  [ RasMol ]  +environment [ RasMol ]
    BCT  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:194 - Ala A:195   [ RasMol ]  
    Asn B:194 - Ala B:195   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1bqd
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AAT_ECOLI | P00509
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.6.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AAT_ECOLI | P00509
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AAT_ECOLI | P00509: 1aam 1aaw 1ahe 1ahf 1ahg 1ahx 1ahy 1aia 1aib 1aic 1amq 1amr 1ams 1arg 1arh 1ari 1ars 1art 1asa 1asb 1asc 1asd 1ase 1asf 1asg 1asl 1asm 1asn 1b4x 1bqa 1c9c 1cq6 1cq7 1cq8 1czc 1cze 1g4v 1g4x 1g7w 1g7x 1ix6 1ix7 1ix8 1qir 1qis 1qit 1spa 1toe 1tog 1toi 1toj 1tok 1x28 1x29 1x2a 1yoo 2aat 2d5y 2d61 2d63 2d64 2d65 2d66 2d7y 2d7z 2q7w 2qa3 2qb2 2qb3 2qbt 3aat 3qn6 3qpg 3zzj 3zzk 4a00 4dbc 4f5f 4f5g 4f5h 4f5i 4f5j 4f5k 4f5l 4f5m 5eaa 5t4l

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1BQD)