1BQD - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   ASPARTATE AMINOTRANSFERASE P138A/P195A DOUBLE MUTANT

Authors :   V. N. Malashkevich, J. N. Jansonius

Date :   14 Aug 98 (Deposition) - 11 May 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.10

Chains :   Asym./Biol. Unit : A,B

Keywords :   Transferase, Aminotransferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. Birolo, V. N. Malashkevich, G. Capitani, F. De Luca, A. Moretta, J. N. Jansonius, G. Marino
Functional And Structural Analysis Of Cis-Proline Mutants Of Escherichia Coli Aspartate Aminotransferase.
Biochemistry V. 38 905 1999
PubMed-ID: 9893985 | Reference-DOI: 10.1021/BI981467D
(for further references see the PDB file header)

Molecule 1 - ASPARTATE AMINOTRANSFERASE
	Chains	:	A, B
	EC Number	:	2.6.1.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PKDHE19
	Expression System Taxid	:	562
	Mutation	:	YES
	Organism Scientific	:	ESCHERICHIA COLI
	Organism Taxid	:	562
	Other Details	:	SCHIFF BASE BETWEEN LYS 258 AND COFACTOR, PYRIDOXAL-5'-PHOSPHATE (PLP)
	Strain	:	TY103
	Synonym	:	ASPARTATE TRANSAMINASE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	LLP	2	Mod. Amino Acid	2-LYSINE(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHANE)

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	ACT	UNKNOWN	ASP A:15 , ILE A:17 , LEU A:18 , ILE A:37 , GLY A:38 , VAL A:39 , TYR B:70 , GLY A:107 , GLY A:108 , THR A:109 , TRP A:140 , ASN A:194 , ASP A:222 , ALA A:224 , TYR A:225 , SER A:255 , LLP A:258 , ARG A:266 , ARG B:292 , SER B:296 , ASN B:297 , PHE A:360 , ARG A:386	ACTIVE SITE OF SUBUNIT A
2	BCT	UNKNOWN	ASP B:15 , ILE B:17 , LEU B:18 , ILE B:37 , GLY B:38 , VAL B:39 , TYR A:70 , GLY B:107 , GLY B:108 , THR B:109 , TRP B:140 , ASN B:194 , ASP B:222 , ALA B:224 , TYR B:225 , SER B:255 , LLP B:258 , ARG B:266 , ARG A:292 , SER A:296 , ASN A:297 , PHE B:360 , ARG B:386	ACTIVE SITE OF SUBUNIT B

(no "SS Bond" information available for 1BQD)

Asymmetric/Biological Unit

No.	Residues
1	Asn A:194	-	Ala A:195
2	Asn B:194	-	Ala B:195

(no "SAP(SNP)/Variant" information available for 1BQD)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	AA_TRANSFER_CLASS_1	PS00105	Aminotransferases class-I pyridoxal-phosphate attachment site.	AAT_ECOLI	243-256	2	A:255-268 B:255-268

(no "Exon" information available for 1BQD)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:396
 aligned with AAT_ECOLI | P00509 from UniProtKB/Swiss-Prot  Length:396

    Alignment length:396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      
            AAT_ECOLI     1 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396
               SCOP domains d1bqda_ A: Aspartate aminotransferase, AAT                                                                                                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ----------1bqdA01 A:15-48,A:328-408         1bqdA02 A:49-327 Type I PLP-dependent aspartate aminotransferase-like (Major domain)                                                                                                                                                                                           1bqdA01 A:15-48,A:328-408 Aspartate Aminotransferase, domain 1                  - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhhhhh.........................hhhhhhhhhhhhh............hhhhhhhhhhhh....hhhh...eeeeeeehhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhh..eeeeee..........hhhhhhhhhh.....eeeee............hhhhhhhhhhhhhh..eeeeee..........hhhhhhhhhh.....eeeeee.......hhh.eeeeeee...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhh....eee....hhhhhhhhhhh........eeehhh.....hhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AA_TRANSFER_CL-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bqd A   5 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNASWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSkNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 409
                                    14        24        34        44        54        64|       75        85        95       105       115       125|||    140       150 ||    161       171       181       191       201       211       221       231|      242       252     | 262       272       282       292       302       312       322       332       342       352       362       372       382       392       402  ||  
                                                                                      64|                                                         126||                152|                                                                          231|                      258-LLP                                                                                                                                            405|  
                                                                                       66                                                          129|                 154                                                                           233                                                                                                                                                                          407  
                                                                                                                                                    133

Chain B from PDB  Type:PROTEIN  Length:396
 aligned with AAT_ECOLI | P00509 from UniProtKB/Swiss-Prot  Length:396

    Alignment length:396
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390      
            AAT_ECOLI     1 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 396
               SCOP domains d1bqdb_ B: Aspartate aminotransferase, AAT                                                                                                                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ----------1bqdB01 B:15-48,B:328-408         1bqdB02 B:49-327 Type I PLP-dependent aspartate aminotransferase-like (Major domain)                                                                                                                                                                                           1bqdB01 B:15-48,B:328-408 Aspartate Aminotransferase, domain 1                  - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...........hhhhhhhhhh.........................hhhhhhhhhhhhh............hhhhhhhhhhhh....hhhh...eeeeeeehhhhhhhhhhhhhhhh....eeeeee...hhhhhhhhhh..eeeeee..........hhhhhhhhhh.....eeeee............hhhhhhhhhhhhhh..eeeeee..........hhhhhhhhhh.....eeeeee.......hhh.eeeeeee...hhhhhhhhhhhhhhhh.......hhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhh....eee....hhhhhhhhhhh........eeehhh.....hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AA_TRANSFER_CL-------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1bqd B   5 MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNASWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNATGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSkNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL 409
                                    14        24        34        44        54        64|       75        85        95       105       115       125|||    140       150 ||    161       171       181       191       201       211       221       231|      242       252     | 262       272       282       292       302       312       322       332       342       352       362       372       382       392       402  ||  
                                                                                      64|                                                         126||                152|                                                                          231|                      258-LLP                                                                                                                                            405|  
                                                                                       66                                                          129|                 154                                                                           233                                                                                                                                                                          407  
                                                                                                                                                    133

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: PLP-dependent transferase-like (627)

Superfamily: PLP-dependent transferases (625)

Family: AAT-like (184)

Protein domain: Aspartate aminotransferase, AAT (112)

Escherichia coli [TaxId: 562] (81)

1a	d1bqda_	A:
1b	d1bqdb_	B:

(no "Pfam Domain" information available for 1BQD)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (AAT_ECOLI | P00509)

molecular function
	GO:0004069	L-aspartate:2-oxoglutarate aminotransferase activity	Catalysis of the reaction: L-aspartate + 2-oxoglutarate = oxaloacetate + L-glutamate.
	GO:0080130	L-phenylalanine:2-oxoglutarate aminotransferase activity	Catalysis of the reaction: L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate.
	GO:0004838	L-tyrosine:2-oxoglutarate aminotransferase activity	Catalysis of the reaction: L-tyrosine + 2-oxoglutarate = 4-hydroxyphenylpyruvate + L-glutamate.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0030170	pyridoxal phosphate binding	Interacting selectively and non-covalently with pyridoxal 5' phosphate, 3-hydroxy-5-(hydroxymethyl)-2-methyl4-pyridine carboxaldehyde 5' phosphate, the biologically active form of vitamin B6.
	GO:0008483	transaminase activity	Catalysis of the transfer of an amino group to an acceptor, usually a 2-oxo acid.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0009094	L-phenylalanine biosynthetic process	The chemical reactions and pathways resulting in the formation of L-phenylalanine, the L-enantiomer of 2-amino-3-phenylpropanoic acid, i.e. (2S)-2-amino-3-phenylpropanoic acid.
	GO:0033585	L-phenylalanine biosynthetic process from chorismate via phenylpyruvate	The chemical reactions and pathways resulting in the formation of L-phenylalanine from other compounds, including chorismate, via the intermediate phenylpyruvate.
	GO:0009058	biosynthetic process	The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
	GO:0006520	cellular amino acid metabolic process	The chemical reactions and pathways involving amino acids, carboxylic acids containing one or more amino groups, as carried out by individual cells.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		LLP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		ACT	[ RasMol ]	+environment [ RasMol ]
		BCT	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Asn A:194 - Ala A:195	[ RasMol ]
		Asn B:194 - Ala B:195	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1bqd
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AAT_ECOLI \| P00509
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.6.1.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AAT_ECOLI \| P00509
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1BQD)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (14, 14)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File