5LWN - JenaLib

Title :   CRYSTAL STRUCTURE OF JAK3 IN COMPLEX WITH COMPOUND 5 (FM409)

Authors :   A. Chaikuad, M. Forster, S. Mukhopadhyay, K. Kupinska, K. Ellis, P. Mah N. Burgess-Brown, A. M. Edwards, C. H. Arrowsmith, C. Bountra, S. A. La S. Knapp, Structural Genomics Consortium (Sgc)

Date :   18 Sep 16 (Deposition) - 26 Oct 16 (Release) - 30 Nov 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.60

Chains :   Asym./Biol. Unit : A

Keywords :   Transferase, Jak3, Covalent Inhibitor, Reversible Covalent Inhibitor, Induced Pocket, Arginine Pocket, Structural Genomics, Structural Genomics Consortium, Sgc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Forster, A. Chaikuad, S. M. Bauer, J. Holstein, M. B. Robers, C. R. Corona, M. Gehringer, E. Pfaffenrot, K. Ghoreschi, S. Knapp, S. A. Laufer
Selective Jak3 Inhibitors With A Covalent Reversible Bindin Mode Targeting A New Induced Fit Binding Pocket.
Cell Chem Biol V. 23 1335 2016
PubMed-ID: 27840070 | Reference-DOI: 10.1016/J.CHEMBIOL.2016.10.008

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 9)

Sites (9, 9)

Asymmetric Unit (9, 9)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TRP A:1011 , PRO A:1030 , ARG A:1059 , LEU A:1060 , TRP A:1078 , HOH A:1352	binding site for residue PHU A 1201
2	AC2	SOFTWARE	ASP A:846 , THR A:848 , ASP A:863 , ARG A:866 , ASP A:867 , ARG A:870	binding site for residue EDO A 1202
3	AC3	SOFTWARE	GLY A:831 , VAL A:836 , LYS A:855 , 79R A:1208 , 79S A:1209 , HOH A:1345 , HOH A:1353 , HOH A:1375	binding site for residue EDO A 1203
4	AC4	SOFTWARE	SER A:924 , ARG A:925 , LEU A:928 , TRP A:1099 , HOH A:1331	binding site for residue EDO A 1204
5	AC5	SOFTWARE	HIS A:917 , ARG A:920 , PRO A:996 , LEU A:1054 , GLU A:1055 , ARG A:1059 , PRO A:1080 , HOH A:1393	binding site for residue EDO A 1205
6	AC6	SOFTWARE	ASP A:979 , GLN A:1007 , GLN A:1083 , HOH A:1317 , HOH A:1482	binding site for residue EDO A 1206
7	AC7	SOFTWARE	ARG A:911 , GLU A:1019 , CYS A:1024 , ASP A:1025 , SER A:1029 , HOH A:1306 , HOH A:1309	binding site for residue EDO A 1207
8	AC8	SOFTWARE	LEU A:828 , ALA A:853 , GLU A:903 , TYR A:904 , LEU A:905 , CYS A:909 , ARG A:911 , ASP A:912 , ARG A:953 , LEU A:956 , EDO A:1203 , 79S A:1209 , HOH A:1409	binding site for residue 79R A 1208
9	AC9	SOFTWARE	LEU A:828 , ALA A:853 , GLU A:903 , TYR A:904 , LEU A:905 , CYS A:909 , ARG A:911 , ASP A:912 , ARG A:953 , LEU A:956 , EDO A:1203 , 79R A:1208 , HOH A:1407 , HOH A:1409	binding site for residue 79S A 1209

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:290
                                                                                                                                                                                                                                                                                                                                   
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee...eeeeeeeee...eeeeeeee........eeeeeeee...hhhhhhhhhhhhhhhhhh.......eeeeee......eeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee..eeee......ee......eee.......hhhhhhhhhhhhheeehhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh......hhhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5lwn A  814 PTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRALAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGSERDVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGSR 1103
                                   823       833       843       853       863       873       883       893       903       913       923       933       943       953       963       973       983       993      1003      1013      1023      1033      1043      1053      1063      1073      1083      1093      1103

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (54, 54)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		79R	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		79S	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PHU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5lwn)

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5lwn
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	JAK3_HUMAN \| P52333
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.10.2
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description