Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF JAK3 COMPLEXED TO N-[3-(6-PHENYLAMINO-PYRAZIN-2-YL)-3H-BENZOIMIDAZOL-5-YL]-ACRYLAMIDE
 
Authors :  M. A. Argiriadi, E. R. Goedken
Date :  24 Jun 14  (Deposition) - 14 Jan 15  (Release) - 11 Mar 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym. Unit :  A,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  C  (1x)
Keywords :  Kinase Catalytic Domain, Transferase, Transferase-Transferase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. R. Goedken, M. A. Argiriadi, D. L. Banach, B. A. Fiamengo, S. E. Foley K. E. Frank, J. S. George, C. M. Harris, A. D. Hobson, D. C. Ihle, D. Marcotte, P. J. Merta, M. E. Michalak, S. E. Murdock, M. J. Tomlinson J. W. Voss
Tricyclic Covalent Inhibitors Selectively Target Jak3 Through An Active Site Thiol.
J. Biol. Chem. V. 290 4573 2015
PubMed-ID: 25552479  |  Reference-DOI: 10.1074/JBC.M114.595181

(-) Compounds

Molecule 1 - TYROSINE-PROTEIN KINASE JAK3
    Chains: A, C
    EC Number: 2.7.10.2
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Taxid: 7108
    Fragment: JAK3, UNP RESIDUES 811-1103
    Gene: JAK3
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: JANUS KINASE 3, JAK-3, LEUKOCYTE JANUS KINASE, L-JAK

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AC
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
137Q2Ligand/IonN-{1-[6-(PHENYLAMINO)PYRAZIN-2-YL]-1H-BENZIMIDAZOL-6-YL}PROP-2-ENAMIDE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
137Q1Ligand/IonN-{1-[6-(PHENYLAMINO)PYRAZIN-2-YL]-1H-BENZIMIDAZOL-6-YL}PROP-2-ENAMIDE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
137Q1Ligand/IonN-{1-[6-(PHENYLAMINO)PYRAZIN-2-YL]-1H-BENZIMIDAZOL-6-YL}PROP-2-ENAMIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:828 , VAL A:836 , ALA A:853 , MET A:902 , GLU A:903 , TYR A:904 , LEU A:905 , GLY A:908 , CYS A:909 , ASP A:912 , ARG A:953 , LEU A:956 , HOH A:1385BINDING SITE FOR RESIDUE 37Q A 1201
2AC2SOFTWARELEU C:828 , GLY C:829 , PHE C:833 , VAL C:836 , ALA C:853 , GLU C:903 , TYR C:904 , LEU C:905 , GLY C:908 , CYS C:909 , ARG C:953 , LEU C:956 , ASP C:967 , HOH C:1301 , HOH C:1307 , HOH C:1365BINDING SITE FOR RESIDUE 37Q C 1201

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4QPS)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Gly C:892 -Pro C:893

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4QPS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4QPS)

(-) Exons   (0, 0)

(no "Exon" information available for 4QPS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:270
                                                                                                                                                                                                                                                                                                               
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeehhh.eeeeeeeee...eeeeeee.........eeeeee..hhhhhhhhhhhhhh........eeeee...eeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee..eeee......ee......eee......hhhhhhhheeehhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                4qps A  814 PTIFEERHLKYISQLGKGNGSVELCRYDPLGDNTGALVAVKQLDQQRDFQREIQILKALHSDFIVKYRGVSYSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRALAARNILVESEAHVKIADFGLAKLLPLDKDYYVVPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGSERDVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWS 1100
                                   823       834       844       854  ||   869       879       889 ||    904       914       924       934       944       954       964       974       990      1000      1010      1020      1030      1040      1050      1060      1070      1080      1090      1100
                                            832|                    857|                         891|                                                                                   983|                                                                                                              
                                             834                     863                          897                                                                                    990                                                                                                              


Chain C from PDB  Type:PROTEIN  Length:276
                                                                                                                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .ee.hhh.eeeeeeeeee..eeeeeeee........eeeeeee..hhhhhhhhhhhhhhhhhh.......eeeeee......eeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eeeee..eeee......ee......eee..hhhhhhhhhhhhheeehhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhh.........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                4qps C  814 PTIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRALAARNILVESEAHVKIADFGLAKLLPLDKDYYVVSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMGSLSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWSGS 1102
                                   823       833       843       853   ||  865       875       885       895       905       915       925       935       945       955       965       975       990      1000      1010      1020      1030      1040|     1056      1066      1076      1086      1096      
                                                                     857|                                                                                                                        983|                                               1040|                                                       
                                                                      860                                                                                                                         989                                                1047
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4QPS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4QPS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4QPS)

(-) Gene Ontology  (54, 54)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    37Q  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly C:892 - Pro C:893   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4qps
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  JAK3_HUMAN | P52333
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  JAK3_HUMAN | P52333
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        JAK3_HUMAN | P52333: 1yvj 3lxk 3lxl 3pjc 3zc6 3zep 4hvd 4hvg 4hvh 4hvi 4i6q 4qt1 4rio 4v0g 4z16 5lwm 5lwn 5toz 5tts 5ttu 5ttv 5vo6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4QPS)