Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  APO-STRUCTURE OF HUMANISED RADA-MUTANT HUMRADA14
 
Authors :  M. Marsh, G. Fischer, T. Moschetti, T. Sharpe, D. Scott, M. Morgan, H. Ng J. Skidmore, A. Venkitaraman, C. Abell, T. L. Blundell, M. Hyvonen
Date :  15 Jun 16  (Deposition) - 19 Oct 16  (Release) - 30 Nov 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.98
Chains :  Asym./Biol. Unit :  A
Keywords :  Dna Repair, Fragment Based Drug Design, Humanisation, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Moschetti, T. Sharpe, G. Fischer, M. E. Marsh, H. K. Ng, M. Morgan, D. E. Scott, T. L. Blundell, A. R Venkitaraman, J. Skidmore, C. Abell, M. Hyvonen
Engineering Archeal Surrogate Systems For The Development O Protein-Protein Interaction Inhibitors Against Human Rad51.
J. Mol. Biol. V. 428 4589 2016
PubMed-ID: 27725183  |  Reference-DOI: 10.1016/J.JMB.2016.10.009

(-) Compounds

Molecule 1 - DNA REPAIR AND RECOMBINATION PROTEIN RADA
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PBAT4
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: RADA, PF1926
    Mutation: YES
    Organism Scientific: PYROCOCCUS FURIOSUS (STRAIN ATCC 43587 / DSM 3638 / JCM 8422 / VC1)
    Organism Taxid: 186497
    Strain: ATCC 43587 / DSM 3638 / JCM 8422 / VC1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 5LB4)

(-) Sites  (0, 0)

(no "Site" information available for 5LB4)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5LB4)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Asp A:238 -Ser A:239
2Lys A:319 -Gly A:320

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5LB4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5LB4)

(-) Exons   (0, 0)

(no "Exon" information available for 5LB4)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:211
                                                                                                                                                                                                                                                   
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...ee...hhhhhhhhh..ee..eeeeee.....hhhhhhhhhhhhhhhhhhhh....eeeeee.....hhhhhhhhhhhh..hhhhhhhheeeee..hhhhhhhhhhhhhhhhhhhhh....eeeeeee..hhhhhhhh...hhhhhhhhhhhhhhhhhh..eeeeee....eeeeee....eeeeeee........eeeeeee..eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5lb4 A 109 TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSAMYIDTENTFRPERIREIAQNRGLDPDEVLKHIAYARAFNSNHQMQLLYQASAMMVESLNTDRPYKLLIVDSLTSHFRSEYAERQQKLARFLAMLHRLANEFDIAVFVTNQATLRVYLRKGKGGKRIARLIDAPHLPEGEAVFSITEKGIED 349
                                   118       128       138       148       158       168       178       188       198       208       218       228       238       248|      264       274       284|      318       328       338       348 
                                                                                                                                                                     248|                          284|                                        
                                                                                                                                                                      255                           309
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5LB4)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5LB4)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5LB4)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 5lb4)
 
  Sites
(no "Sites" information available for 5lb4)
 
  Cis Peptide Bonds
    Asp A:238 - Ser A:239   [ RasMol ]  
    Lys A:319 - Gly A:320   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5lb4
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  RADA_PYRFU | O74036
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  RADA_PYRFU | O74036
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        RADA_PYRFU | O74036: 1pzn 4a6p 4a6x 4b2i 4b2l 4b2p 4b32 4b33 4b34 4b35 4b3b 4b3c 4b3d 4d6p 4uqo 5fos 5fot 5fou 5fov 5fow 5fox 5fpk 5j4h 5j4k 5j4l 5jec 5jed 5jee 5jfg 5kdd 5l8v 5lb2 5lbi

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5LB4)