Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF FRAGMENT (3-[6-OXO-3-(3-PYRIDINYL)-1(6H)-PYRIDAZINYL]PROPANOIC ACID) BOUND IN THE UBIQUITIN BINDING POCKET OF THE HDAC6 ZINC-FINGER DOMAIN
 
Authors :  R. J. Harding, J. Walker, M. Ravichandran, R. Ferreira De Freitas, M. C. Bountra, A. M. Edwards, V. Santhakumar, C. M. Arrowsmith, Structur Genomics Consortium (Sgc)
Date :  14 Jun 16  (Deposition) - 27 Jul 16  (Release) - 27 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym./Biol. Unit :  A
Keywords :  Histone Deacetylase, Hdac, Hdac6, Fragment Screening, Structural Genomics Consortium, Sgc, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. J. Harding, J. Walker, M. Ravichandran, R. Ferreira De Freitas, M. Schapira, C. Bountra, A. M. Edwards, V. Santhakumar, C. M. Arrowsmith, Structural Genomics Consortium (Sgc)
Crystal Structure Of Fragment (3-[6-Oxo-3-(3-Pyridinyl)-1(6H)-Pyridazinyl]Propanoic Acid) Bound In The Ubiquitin Binding Pocket Of The Hdac6 Zinc-Finger Domain
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HISTONE DEACETYLASE 6
    ChainsA
    EC Number3.5.1.98
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28-LIC
    Expression System StrainBL21 (DE3) CODON PLUS
    Expression System Taxid469008
    GeneHDAC6, KIAA0901, JM21
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymHD6

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 19)

Asymmetric/Biological Unit (3, 19)
No.NameCountTypeFull Name
16T71Ligand/Ion3-(6-OXIDANYLIDENE-3-PYRIDIN-3-YL-PYRIDAZIN-1-YL)PROPANOIC ACID
2UNX15Ligand/IonUNKNOWN ATOM OR ION
3ZN3Ligand/IonZINC ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:1145 , CYS A:1148 , HIS A:1164 , HIS A:1170binding site for residue ZN A 1301
2AC2SOFTWARECYS A:1133 , CYS A:1136 , CYS A:1153 , HIS A:1160binding site for residue ZN A 1302
3AC3SOFTWARECYS A:1113 , HIS A:1115 , CYS A:1183 , CYS A:1186binding site for residue ZN A 1303
4AC4SOFTWARETRP A:1143 , GLY A:1154 , ARG A:1155 , TRP A:1182 , TYR A:1184 , TYR A:1189 , HIS A:1203 , HOH A:1409binding site for residue 6T7 A 1304

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5KH7)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5KH7)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5KH7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5KH7)

(-) Exons   (0, 0)

(no "Exon" information available for 5KH7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:101
                                                                                                                                      
               SCOP domains ----------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhh......................eeee.....eee.....hhhhhhhhhhh..eeee.....eee....ee..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                5kh7 A 1108 SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG 1208
                                  1117      1127      1137      1147      1157      1167      1177      1187      1197      1207 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5KH7)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5KH7)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5KH7)

(-) Gene Ontology  (90, 90)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    6T7  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNX  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5kh7)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5kh7
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HDAC6_HUMAN | Q9UBN7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.1.98
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  HDAC6_HUMAN | Q9UBN7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HDAC6_HUMAN | Q9UBN73c5k 3gv4 3phd 5b8d 5edu 5kh3 5kh9

(-) Related Entries Specified in the PDB File

5b8d 5kh3 5kh9