Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE ANAPLASTIC LYMPHOMA KINASE (ALK) IN COMPLEX WITH 5D
 
Authors :  C. H. Tu, S. Y. Wu
Date :  18 Mar 16  (Deposition) - 18 May 16  (Release) - 18 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A
Keywords :  Catalytic Domain, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. H. Tu, W. H. Lin, Y. H. Peng, T. Hsu, J. S. Wu, C. Y. Chang, C. T. Lu, P. C. Lyu, C. Shih, W. T. Jiaang, S. Y. Wu
Pyrazolylamine Derivatives Reveal The Conformational Switching Between Type I And Type Ii Binding Modes Of Anaplastic Lymphoma Kinase (Alk).
J. Med. Chem. V. 59 3906 2016
PubMed-ID: 27031565  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.6B00106

(-) Compounds

Molecule 1 - ALK TYROSINE KINASE RECEPTOR
    ChainsA
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Cell LineSF21
    Expression System CommonFALL ARMYWORM
    Expression System Taxid7108
    Expression System VectorPBAKPAK-8
    Expression System Vector TypeBACULOVIRUS
    FragmentUNP RESIDUES 1084-1410
    GeneALK
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymANAPLASTIC LYMPHOMA KINASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
134Y1Ligand/Ion4-[(4-METHYLPIPERAZIN-1-YL)METHYL]-N-{3-[3-METHYL-4-({[5-(PROPAN-2-YL)-1,2-OXAZOL-3-YL]CARBAMOYL}AMINO)PHENYL]-1H-PYRAZOL-5-YL}BENZAMIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:1148 , GLU A:1167 , ILE A:1171 , PHE A:1174 , VAL A:1180 , LEU A:1196 , GLU A:1197 , MET A:1199 , ALA A:1200 , GLY A:1201 , GLY A:1202 , PHE A:1245 , HIS A:1247 , LEU A:1256 , GLY A:1269 , ASP A:1270 , HOH A:1665binding site for residue 34Y A 1501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5IUH)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Leu A:1190 -Pro A:1191

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5IUH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5IUH)

(-) Exons   (0, 0)

(no "Exon" information available for 5IUH)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:285
                                                                                                                                                                                                                                                                                                                              
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhh...hhh.eeeeee...eeeeee...eeeeeee.....hhhhhhhhhhhhhhhhh........eeeee......eeeee....eehhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee........eee..........hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                5iuh A 1093 NPNYSFAGKTSSISDLKEVPRKNITLIRGLGEVYEGQVSGPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMACAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYGPL 1404
                                  1102      1112      1122||    1137|     1153      1163      1173      1183      1193      1203      1213 ||   1226      1236      1246      1256      1266      1289      1299      1309      1319      1329      1339      1349      1359      1369      1379      1389      1399     
                                                       1123|    1137|                                                                   1215|                                                   1274|                                                                                                                    
                                                        1129     1144                                                                    1219                                                    1288                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5IUH)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5IUH)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5IUH)

(-) Gene Ontology  (30, 30)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    34Y  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:1190 - Pro A:1191   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5iuh
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ALK_HUMAN | Q9UM73
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ALK_HUMAN | Q9UM73
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ALK_HUMAN | Q9UM732kup 2kuq 2xb7 2xba 2xp2 2yfx 2yhv 2yjr 2yjs 2ys5 2yt2 3aox 3l9p 3lcs 3lct 4anl 4anq 4ans 4ccb 4ccu 4cd0 4cli 4clj 4cmo 4cmt 4cmu 4cnh 4ctb 4ctc 4dce 4fnw 4fnx 4fny 4fnz 4fob 4foc 4fod 4joa 4mkc 4tt7 4z55 5a9u 5aa8 5aa9 5aaa 5aab 5aac 5fto 5ftq 5imx 5iug 5iui 5j7h 5kz0

(-) Related Entries Specified in the PDB File

5iug 5iui