Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN ANAPLASTIC LYMPHOMA KINASE IN COMPLEX WITH ACYLIMINOBENZIMIDAZOLE INHIBITOR 1
 
Authors :  D. A. Whittington, L. F. Epstein, H. Chen
Date :  20 Jun 12  (Deposition) - 11 Jul 12  (Release) - 15 Aug 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A
Keywords :  Receptor Tyrosine Kinase, Inhibitor, Crizotinib, Neuroblastoma, Cd246, Phosphotransferase, Npm-Alk, Eml4-Alk, In Situ Proteolysis, Transferase-Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. T. Lewis, C. M. Bode, D. M. Choquette, M. Potashman, K. Romero, J. C. Stellwagen, Y. Teffera, E. Moore, D. A. Whittington, H. Chen, L. F. Epstein, R. Emkey, P. S. Andrews, V. L. Yu, D. C. Saffran, M. Xu, A. Drew, P. Merkel, S. Szilvassy, R. L. Brake
The Discovery And Optimization Of A Novel Class Of Potent, Selective, And Orally Bioavailable Anaplastic Lymphoma Kinase (Alk) Inhibitors With Potential Utility For The Treatment Of Cancer.
J. Med. Chem. V. 55 6523 2012
PubMed-ID: 22734674  |  Reference-DOI: 10.1021/JM3005866

(-) Compounds

Molecule 1 - ALK TYROSINE KINASE RECEPTOR
    ChainsA
    EC Number2.7.10.1
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    Expression System Vector TypeBACULOVIRUS
    FragmentKINASE DOMAIN, UNP RESIDUES 1058-1410
    GeneALK
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymANAPLASTIC LYMPHOMA KINASE

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
10US1Ligand/IonN-{1-[CIS-4-(HYDROXYMETHYL)CYCLOHEXYL]-5-(PIPERIDIN-1-YLMETHYL)-1H-BENZIMIDAZOL-2-YL}-3-(PROP-2-EN-1-YLSULFAMOYL)BENZAMIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARELEU A:1122 , HIS A:1124 , GLY A:1125 , VAL A:1130 , ALA A:1148 , LEU A:1196 , GLU A:1197 , MET A:1199 , ALA A:1200 , GLY A:1201 , ARG A:1253 , LEU A:1256 , GLY A:1269 , HOH A:1758 , HOH A:1764BINDING SITE FOR RESIDUE 0US A 1501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4FOB)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Leu A:1190 -Pro A:1191

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4FOB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4FOB)

(-) Exons   (0, 0)

(no "Exon" information available for 4FOB)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:295
                                                                                                                                                                                                                                                                                                                                        
               SCOP domains d4foba_ A: automated matches                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..eeehhhhh...hhh.eeeeeeeee....eeeeeee...eeeeeee.....hhhhhhhhhhhhhhhhhh.......eeeee......eeeee....eehhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee........eee..hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh..........hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4fob A 1093 NPNYSFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYG 1402
                                  1102      1112      1122      1132   || 1148      1158      1168      1178      1188      1198      1208      1221      1231      1241      1251      1261      1271      1287      1297      1307      1317      1327      1337      1347      1357      1367      1377      1387      1397     
                                                                    1136|                                                                    1215|                                                         1280|                                                                                                                   
                                                                     1143                                                                     1219                                                          1287                                                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4FOB)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4FOB)

(-) Gene Ontology  (30, 30)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    0US  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:1190 - Pro A:1191   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4fob
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ALK_HUMAN | Q9UM73
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.10.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ALK_HUMAN | Q9UM73
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ALK_HUMAN | Q9UM732kup 2kuq 2xb7 2xba 2xp2 2yfx 2yhv 2yjr 2yjs 2ys5 2yt2 3aox 3l9p 3lcs 3lct 4anl 4anq 4ans 4ccb 4ccu 4cd0 4cli 4clj 4cmo 4cmt 4cmu 4cnh 4ctb 4ctc 4dce 4fnw 4fnx 4fny 4fnz 4foc 4fod 4joa 4mkc 4tt7 4z55 5a9u 5aa8 5aa9 5aaa 5aab 5aac 5fto 5ftq 5imx 5iug 5iuh 5iui 5j7h 5kz0

(-) Related Entries Specified in the PDB File

4fnw 4fnx 4fny 4fnz 4foc 4fod