Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MACROPHAGE MIGRATION INHIBITORY FACTOR (MIF) WITH A POTENT INHIBITOR (NVS-2)
 
Authors :  M. J. Robertson, W. L. Jorgensen
Date :  28 Jan 16  (Deposition) - 29 Jun 16  (Release) - 20 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.75
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Cytokine, Inhibitor, Complex, Isomerase-Isomerase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. A. Cisneros, M. J. Robertson, M. Valhondo, W. L. Jorgensen
A Fluorescence Polarization Assay For Binding To Macrophage Migration Inhibitory Factor And Crystal Structures For Complexes Of Two Potent Inhibitors.
J. Am. Chem. Soc. V. 138 8630 2016
PubMed-ID: 27299179  |  Reference-DOI: 10.1021/JACS.6B04910

(-) Compounds

Molecule 1 - MACROPHAGE MIGRATION INHIBITORY FACTOR
    ChainsA, B, C
    EC Number5.3.2.1, 5.3.3.12
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneMIF, GLIF, MMIF
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymMIF,GLYCOSYLATION-INHIBITING FACTOR,GIF,L-DOPACHROME ISOMERASE,L-DOPACHROME TAUTOMERASE,PHENYLPYRUVATE TAUTOMERASE

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 15)

Asymmetric/Biological Unit (4, 15)
No.NameCountTypeFull Name
1GOL3Ligand/IonGLYCEROL
2IPA3Ligand/IonISOPROPYL ALCOHOL
3NVS3Ligand/Ion7-HYDROXY-3-(4-METHOXYPHENYL)-3,4-DIHYDRO-2H-1,3-BENZOXAZIN-2-ONE
4SO46Ligand/IonSULFATE ION

(-) Sites  (15, 15)

Asymmetric Unit (15, 15)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLY A:68 , GLY A:69 , ALA A:70 , GLN A:71 , HOH A:349binding site for residue SO4 A 201
02AC2SOFTWAREPRO A:1 , MET A:2 , LYS A:32 , TYR A:36 , HIS A:62 , SER A:63 , ILE A:64 , MET A:101 , VAL A:106 , PHE A:113 , TYR B:95 , ASN B:97 , TRP B:108 , ASN B:109binding site for residue NVS A 202
03AC3SOFTWAREHIS A:62 , TYR A:99 , HIS B:62 , TYR B:99 , HIS C:62 , TYR C:99binding site for residue SO4 A 203
04AC4SOFTWAREGLN A:35 , TYR A:36 , HOH A:360 , HOH A:372 , GLN B:35 , PHE C:49 , ASP C:92 , ARG C:93binding site for residue GOL A 204
05AC5SOFTWAREGLY A:65 , LYS A:66 , GLN A:71binding site for residue GOL A 205
06AC6SOFTWAREARG A:73 , HOH A:305 , HOH A:316 , HOH B:310binding site for residue IPA A 206
07AC7SOFTWAREGLY B:68 , GLY B:69 , ALA B:70 , GLN B:71 , HOH B:360binding site for residue SO4 B 201
08AC8SOFTWAREPRO B:1 , MET B:2 , LYS B:32 , PRO B:33 , TYR B:36 , HIS B:62 , SER B:63 , ILE B:64 , ASP B:92 , MET B:101 , VAL B:106 , PHE B:113 , TYR C:95 , ASN C:97binding site for residue NVS B 202
09AC9SOFTWAREPRO A:15 , ASP A:16 , SER B:53 , HOH B:320binding site for residue SO4 B 203
10AD1SOFTWAREARG A:73 , PRO B:15 , ASP B:16 , HOH B:319 , HOH B:352binding site for residue SO4 B 204
11AD2SOFTWARELYS A:77 , ASP B:16 , GLY B:17 , PHE B:18 , LEU B:19 , SER B:20 , HOH B:306 , HOH B:312 , HOH B:371binding site for residue GOL B 205
12AD3SOFTWAREASN B:102 , ALA B:103 , HOH B:315 , HOH B:351binding site for residue IPA B 206
13AD4SOFTWAREGLY C:68 , GLY C:69 , ALA C:70 , GLN C:71binding site for residue SO4 C 201
14AD5SOFTWARETYR A:95 , ASN A:97 , PRO C:1 , MET C:2 , LYS C:32 , PRO C:33 , TYR C:36 , HIS C:62 , SER C:63 , ILE C:64 , MET C:101 , VAL C:106 , PHE C:113binding site for residue NVS C 202
15AD6SOFTWAREASP C:16 , GLY C:17 , PHE C:18 , LEU C:19 , SER C:20binding site for residue IPA C 203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5HVT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5HVT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HVT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HVT)

(-) Exons   (0, 0)

(no "Exon" information available for 5HVT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:114
                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhh..hhhhhhhhhhhhhhh.hhhh.eeeee...eeee.......eeeeeee....hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee.hhh.eee..ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 5hvt A   1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA 114
                                    10        20        30        40        50        60        70        80        90       100       110    

Chain B from PDB  Type:PROTEIN  Length:114
                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhh..hhhhhhhhhhhhhhh.hhhh.eeeee...eeee.......eeeeeee....hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee.hhh.eee..ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 5hvt B   1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA 114
                                    10        20        30        40        50        60        70        80        90       100       110    

Chain C from PDB  Type:PROTEIN  Length:114
                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhh..hhhhhhhhhhhhhhh.hhhh.eeeee...eeee.......eeeeeee....hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee.hhh.eee..ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 5hvt C   1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA 114
                                    10        20        30        40        50        60        70        80        90       100       110    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HVT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HVT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HVT)

(-) Gene Ontology  (54, 54)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IPA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NVS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5hvt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hvt
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MIF_HUMAN | P14174
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.3.2.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
  5.3.3.12
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  MIF_HUMAN | P14174
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MIF_HUMAN | P141741ca7 1cgq 1gcz 1gd0 1gif 1ljt 1mif 1p1g 2ooh 2oow 2ooz 3b9s 3ce4 3djh 3dji 3hof 3ijg 3ijj 3jsf 3jsg 3jtu 3l5p 3l5r 3l5s 3l5t 3l5u 3l5v 3smb 3smc 3u18 3wnr 3wns 3wnt 4etg 4eui 4evg 4f2k 4grn 4gro 4grp 4grq 4grr 4gru 4gum 4k9g 4osf 4oyq 4p01 4p0h 4pkk 4pkz 4plu 4trf 4tru 4wr8 4wrb 4xx7 4xx8 4z15 4z1t 4z1u 5b4o 5bs9 5bsc 5bsi 5bsj 5cg4 5eiz 5hvs 5hvv 5j7p 5j7q

(-) Related Entries Specified in the PDB File

5hvs