Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  MACROPHAGE MIGRATION INHIBITORY FACTOR IN COMPLEX WITH A BIARYLTRIAZOLE INHIBITOR (3B-190)
 
Authors :  M. J. Robertson, R. H. G. Baxter, W. L. Jorgensen
Date :  23 Oct 14  (Deposition) - 11 Mar 15  (Release) - 22 Mar 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.81
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Cd74 Binding, Tautomerase, Inhibitor, Complex, Isomerase-Isomerase Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Dziedzic, J. A. Cisneros, M. J. Robertson, A. A. Hare, N. E. Danford, R. H. Baxter, W. L. Jorgensen
Design, Synthesis, And Protein Crystallography Of Biaryltriazoles As Potent Tautomerase Inhibitors Of Macrophage Migration Inhibitory Factor.
J. Am. Chem. Soc. V. 137 2996 2015
PubMed-ID: 25697265  |  Reference-DOI: 10.1021/JA512112J

(-) Compounds

Molecule 1 - MACROPHAGE MIGRATION INHIBITORY FACTOR
    Atcc: H33HJ-JA1
    Cell Line: JURKAT
    Chains: A, B, C
    EC Number: 5.3.2.1, 5.3.3.12
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET11B
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: MIF, GLIF, MMIF
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: MIF,GLYCOSYLATION-INHIBITING FACTOR,GIF,L-DOPACHROME ISOMERASE,L-DOPACHROME TAUTOMERASE,PHENYLPYRUVATE TAUTOMERASE

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 16)

Asymmetric/Biological Unit (4, 16)
No.NameCountTypeFull Name
13TW1Ligand/Ion4-{4-[6-(2-METHOXYETHOXY)QUINOLIN-2-YL]-1H-1,2,3-TRIAZOL-1-YL}PHENOL
2GOL5Ligand/IonGLYCEROL
3IPA4Ligand/IonISOPROPYL ALCOHOL
4SO46Ligand/IonSULFATE ION

(-) Sites  (16, 16)

Asymmetric Unit (16, 16)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREPRO A:1 , MET A:2 , LYS A:32 , PRO A:33 , TYR A:36 , HIS A:62 , ILE A:64 , PHE A:113 , GLU B:54 , SER B:90 , ASP B:92 , TYR C:95 , ASN C:97binding site for residue 3TW A 201
02AC2SOFTWAREGLY A:65 , LYS A:66 , IPA A:205 , HOH A:308 , HOH A:354binding site for residue SO4 A 202
03AC3SOFTWAREGLY A:68 , GLY A:69 , ALA A:70 , GLN A:71 , HOH A:348binding site for residue SO4 A 203
04AC4SOFTWAREARG A:73binding site for residue IPA A 204
05AC5SOFTWARELYS A:32 , SO4 A:202 , HOH A:313 , SER B:52 , SER B:53binding site for residue IPA A 205
06AC6SOFTWAREGLY A:17 , SER A:20 , GLU A:21 , GLN A:24 , HOH A:305 , HOH A:307 , LYS B:32 , ILE B:64 , HOH B:301binding site for residue GOL A 206
07AC7SOFTWAREGLY B:68 , GLY B:69 , ALA B:70 , GLN B:71binding site for residue SO4 B 201
08AC8SOFTWARETYR A:95 , ASN A:97 , HOH A:307 , PRO B:1 , MET B:2 , HIS B:62 , SER B:63 , ILE B:64 , MET B:101 , VAL B:106 , HOH B:301binding site for residue GOL B 202
09AC9SOFTWAREARG A:86 , GLY B:65 , LYS B:66 , HOH B:302 , HOH B:307 , HOH B:348binding site for residue SO4 B 203
10AD1SOFTWAREPRO B:15 , ASP B:16 , HOH B:304binding site for residue IPA B 204
11AD2SOFTWAREGLY C:68 , GLY C:69 , ALA C:70 , GLN C:71binding site for residue SO4 C 201
12AD3SOFTWAREGLU B:85 , ARG B:86 , GLY C:65 , LYS C:66binding site for residue SO4 C 202
13AD4SOFTWARETYR B:95 , ASN B:97 , PRO C:1 , MET C:2 , HIS C:62 , SER C:63 , ILE C:64 , VAL C:106 , HOH C:316binding site for residue GOL C 203
14AD5SOFTWAREASP A:92 , ASN B:109 , GLY C:50 , SER C:52 , HOH C:307 , HOH C:339binding site for residue GOL C 204
15AD6SOFTWAREPRO C:15 , ASP C:16 , GLY C:17 , PHE C:18 , LEU C:19 , SER C:20 , HOH C:370binding site for residue GOL C 205
16AD7SOFTWAREARG C:73 , HOH C:360binding site for residue IPA C 206

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4WRB)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 4WRB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4WRB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4WRB)

(-) Exons   (0, 0)

(no "Exon" information available for 4WRB)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:114
                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhh..hhhhhhhhhhhhhhh.hhhh.eeeee...eeee.......eeeeeee....hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee.hhh.eee..ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 4wrb A   1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA 114
                                    10        20        30        40        50        60        70        80        90       100       110    


Chain B from PDB  Type:PROTEIN  Length:114
                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhh..hhhhhhhhhhhhhhh.hhhh.eeeee...eeee.......eeeeeee....hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee.hhh.eee..ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 4wrb B   1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA 114
                                    10        20        30        40        50        60        70        80        90       100       110    


Chain C from PDB  Type:PROTEIN  Length:114
                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhh..hhhhhhhhhhhhhhh.hhhh.eeeee...eeee.......eeeeeee....hhhhhhhhhhhhhhhhhhhhh.hhh.eeeeeee.hhh.eee..ee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 4wrb C   1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA 114
                                    10        20        30        40        50        60        70        80        90       100       110
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4WRB)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4WRB)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4WRB)

(-) Gene Ontology  (54, 54)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    3TW  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IPA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
    AD6  [ RasMol ]  +environment [ RasMol ]
    AD7  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4wrb)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4wrb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MIF_HUMAN | P14174
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.3.2.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
  5.3.3.12
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MIF_HUMAN | P14174
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MIF_HUMAN | P14174: 1ca7 1cgq 1gcz 1gd0 1gif 1ljt 1mif 1p1g 2ooh 2oow 2ooz 3b9s 3ce4 3djh 3dji 3hof 3ijg 3ijj 3jsf 3jsg 3jtu 3l5p 3l5r 3l5s 3l5t 3l5u 3l5v 3smb 3smc 3u18 3wnr 3wns 3wnt 4etg 4eui 4evg 4f2k 4grn 4gro 4grp 4grq 4grr 4gru 4gum 4k9g 4osf 4oyq 4p01 4p0h 4pkk 4pkz 4plu 4trf 4tru 4wr8 4xx7 4xx8 4z15 4z1t 4z1u 5b4o 5bs9 5bsc 5bsi 5bsj 5cg4 5eiz 5hvs 5hvt 5hvv 5j7p 5j7q

(-) Related Entries Specified in the PDB File

4wr8 SAME PROTEIN WITH A SIMILAR INHIBITOR, BUT IN DIFFERENT SPACE GROUP.