Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN BRPF1 IN COMPLEX WITH PFI-4 CHEMICAL PROBE
 
Authors :  C. Tallant, D. R. Owen, B. S. Gerstenberger, P. Savitsky, A. Chaikuad, O G. Nunez-Alonso, P. Filippakopoulos, F. Von Delft, C. H. Arrowsmith A. M. Edwards, C. Bountra, S. Muller, P. E. Brennan, S. Knapp
Date :  20 Dec 15  (Deposition) - 30 Dec 15  (Release) - 30 Dec 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Peregrin, Moz-Morf Complex, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Tallant, D. R. Owen, B. S. Gerstenberger, P. Savitsky, A. Chaikuad, O. Fedorov, G. Nunez-Alonso, P. Filippakopoulos, F. Von Delft, C. H. Arrowsmith, A. M. Edwards, P. E. Brennan, C. Bountra, S. Muller, S. Knapp
Crystal Structure Of The Bromodomain Of Human Brpf1 In Complex With Pfi-4 Chemical Probe
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PEREGRIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PNIC28-BSA4
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: BRPF1, BR140
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: BROMODOMAIN AND PHD FINGER-CONTAINING PROTEIN 1,PROTEIN BR140

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
15XF2Ligand/Ion~{N}-(1,3-DIMETHYL-2-OXIDANYLIDENE-6-PYRROLIDIN-1-YL-BENZIMIDAZOL-5-YL)-2-METHOXY-BENZAMIDE
2NO31Ligand/IonNITRATE ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
15XF1Ligand/Ion~{N}-(1,3-DIMETHYL-2-OXIDANYLIDENE-6-PYRROLIDIN-1-YL-BENZIMIDAZOL-5-YL)-2-METHOXY-BENZAMIDE
2NO3-1Ligand/IonNITRATE ION
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
15XF1Ligand/Ion~{N}-(1,3-DIMETHYL-2-OXIDANYLIDENE-6-PYRROLIDIN-1-YL-BENZIMIDAZOL-5-YL)-2-METHOXY-BENZAMIDE
2NO31Ligand/IonNITRATE ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:635 , ILE A:652 , GLU A:655 , VAL A:657 , PRO A:658 , GLU A:661 , ASN A:708 , PHE A:714 , HOH A:906 , HOH A:917binding site for residue 5XF A 801
2AC2SOFTWAREPRO B:632 , PHE B:633binding site for residue NO3 B 801
3AC3SOFTWAREILE B:635 , LYS B:639 , ASN B:651 , ILE B:652 , PHE B:653 , GLU B:655 , VAL B:657 , PRO B:658 , GLU B:661 , ASN B:708 , PHE B:714 , HOH B:907binding site for residue 5XF B 802

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5FG5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5FG5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5FG5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5FG5)

(-) Exons   (0, 0)

(no "Exon" information available for 5FG5)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:114
                                                                                                                                                  
               SCOP domains ------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhh................hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 5fg5 A 626 MEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKM 739
                                   635       645       655       665       675       685       695       705       715       725       735    


Chain B from PDB  Type:PROTEIN  Length:108
                                                                                                                                            
               SCOP domains ------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhh................hhhhh.....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------ Transcript
                 5fg5 B 629 QLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQA 736
                                   638       648       658       668       678       688       698       708       718       728
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5FG5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5FG5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5FG5)

(-) Gene Ontology  (13, 13)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5XF  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NO3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5fg5)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5fg5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  BRPF1_HUMAN | P55201
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  BRPF1_HUMAN | P55201
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        BRPF1_HUMAN | P55201: 2d9e 2rs9 2x35 2x4w 2x4x 2x4y 3l42 3mo8 4lc2 4qyd 4qyl 4uye 5c6s 5c7n 5c85 5c87 5c89 5d7x 5dy7 5dya 5dyc 5e3d 5e3g 5em3 5epr 5eps 5eq1 5erc 5etb 5etd 5ev9 5eva 5ewc 5ewd 5ewh 5ewv 5eww 5ffv 5ffw 5ffy 5fg4 5g4r 5g4s 5t4u 5t4v

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5FG5)