Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  RAPID DISCOVERY OF PYRIDO[3,4-D]PYRIMIDINE INHIBITORS OF MONOPOLAR SPINDLE KINASE 1 (MPS1) USING A STRUCTURE-BASED HYDRIDIZATION APPROACH
 
Authors :  P. Innocenti, H. L. Woodward, S. Solanki, N. Naud, I. M. Westwood, N. Cro A. Hayes, J. Roberts, A. T. Henley, R. Baker, A. Faisal, G. Mak, G. Box, M A. De Haven Brandon, L. O'Fee, J. Saville, J. Schmitt, R. Burke, R. L. Montfort, F. I. Raymaud, S. A. Eccles, S. Linardopoulos, J. Blagg, S. H
Date :  29 Oct 15  (Deposition) - 20 Apr 16  (Release) - 11 May 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.26
Chains :  Asym./Biol. Unit :  A
Keywords :  Spindle Assembly Checkpoint (Sac), Oncology Target Pyrido[3, 4- D]Pyrimidine Based Inhibitors Selective Against Mps1, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Innocenti, H. L. Woodward, S. Solanki, S. Naud, I. M. Westwood, N. Cronin, A. Hayes, J. Roberts, A. T. Henley, R. Baker, A. Faisal, G. W. Mak, G. Box, M. Valenti, A. De Haven Brandon, L. O'Fee, H. Saville, J. Schmitt, B. Matijssen, R. Burke, R. L. Van Montfort, F. I. Raynaud, S. A. Eccles, S. Linardopoulos, J. Blagg, S. Hoelder
Rapid Discovery Of Pyrido[3, 4-D]Pyrimidine Inhibitors Of Monopolar Spindle Kinase 1 (Mps1) Using A Structure-Based Hybridization Approach.
J. Med. Chem. V. 59 3671 2016
PubMed-ID: 27055065  |  Reference-DOI: 10.1021/ACS.JMEDCHEM.5B01811

(-) Compounds

Molecule 1 - DUAL SPECIFICITY PROTEIN KINASE TTK
    Chains: A
    EC Number: 2.7.12.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Taxid: 511693
    Gene: TTK, MPS1, MPS1L1
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: 4-(FURAN-3-YL)-3-PHENYL-1H-PYRAZOLO[4,3-C]PYRIDINE
    Synonym: PHOSPHOTYROSINE PICKED THREONINE-PROTEIN KINASE,PYT

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 14)

Asymmetric/Biological Unit (4, 14)
No.NameCountTypeFull Name
15O41Ligand/Ion4-(FURAN-3-YL)-3-PHENYL-2~{H}-PYRAZOLO[4,3-C]PYRIDINE
27PE7Ligand/Ion2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHOXY)ETHANOL
3DMS1Ligand/IonDIMETHYL SULFOXIDE
4EDO5Ligand/Ion1,2-ETHANEDIOL

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASN A:576 , LYS A:577 , ASP A:763 , PRO A:789 , EDO A:913 , HOH A:1008binding site for residue 7PE A 901
02AC2SOFTWARELYS A:546 , GLN A:548 , ILE A:549 , TYR A:550 , TYR A:589 , CYS A:604binding site for residue 7PE A 902
03AC3SOFTWARELEU A:613 , LYS A:616 , LYS A:617 , TYR A:726 , MET A:727 , THR A:728 , GLY A:730binding site for residue 7PE A 903
04AC4SOFTWARELYS A:521 , GLU A:592 , GLN A:778 , HOH A:1027binding site for residue 7PE A 904
05AC5SOFTWAREASN A:570 , GLY A:642 , GLN A:794binding site for residue 7PE A 905
06AC6SOFTWARETRP A:622 , LYS A:625 , SER A:626 , LYS A:629 , VAL A:791 , GLN A:792 , ILE A:793 , GLN A:794 , EDO A:911binding site for residue 7PE A 906
07AC7SOFTWARELYS A:553 , VAL A:555 , TYR A:568 , GLU A:571 , ILE A:572 , MET A:600 , ILE A:663 , 5O4 A:908binding site for residue 7PE A 907
08AC8SOFTWAREILE A:531 , ALA A:551 , ILE A:586 , GLU A:603 , GLY A:605 , LEU A:654 , 7PE A:907binding site for residue 5O4 A 908
09AC9SOFTWAREGLN A:541 , GLY A:605 , ASN A:606binding site for residue EDO A 909
10AD1SOFTWAREGLN A:579 , GLN A:580 , SER A:582 , ASP A:583 , ARG A:587binding site for residue DMS A 910
11AD2SOFTWAREASP A:566 , GLN A:792 , 7PE A:906binding site for residue EDO A 911
12AD3SOFTWAREASP A:595 , HIS A:639 , PRO A:713 , ILE A:782 , PRO A:783 , HOH A:1004binding site for residue EDO A 912
13AD4SOFTWAREASN A:576 , LEU A:588 , TYR A:589 , TYR A:591 , 7PE A:901binding site for residue EDO A 913
14AD5SOFTWARETYR A:525 , TYR A:550binding site for residue EDO A 914

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5EHY)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5EHY)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5EHY)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5EHY)

(-) Exons   (0, 0)

(no "Exon" information available for 5EHY)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:255
                                                                                                                                                                                                                                                                                               
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee..eeeeeeeeeee...eeeeeee.....eeeeeeee....hhhhhhhhhhhhhhhhhh.........eeeeee...eeeeee....eehhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh.......hhh.eeee..eeee...............hhhhhhh..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhh............hhhhhhhhhhhh........hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ehy A 515 FQSMSVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQVGTVNYMPPEAIKDMISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQ 794
                                   524       534       544       554       564       574       584       594       604       614       624       634       644       654       664     ||687       697||     719       729       739       749       759       769       779       789     
                                                                                                                                                                                     670|           698|                                                                                   
                                                                                                                                                                                      684            711
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5EHY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5EHY)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5EHY)

(-) Gene Ontology  (21, 21)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5O4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    7PE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    DMS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    EDO  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
    AD4  [ RasMol ]  +environment [ RasMol ]
    AD5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ehy)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ehy
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TTK_HUMAN | P33981
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.12.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TTK_HUMAN | P33981
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TTK_HUMAN | P33981: 2x9e 2zmc 2zmd 3cek 3dbq 3gfw 3h9f 3hmn 3hmo 3hmp 3vqu 3w1f 3wyx 3wyy 3wzj 3wzk 4b94 4bhz 4bi0 4bi1 4bi2 4c4e 4c4f 4c4g 4c4h 4c4i 4c4j 4cv8 4cv9 4cva 4d2s 4h7x 4h7y 4js8 4jt3 4o6l 4zeg 5ap0 5ap1 5ap2 5ap3 5ap4 5ap5 5ap6 5ap7 5eh0 5ehl 5eho 5ei2 5ei6 5ei8 5ljj 5n7v 5n84 5n87 5n93 5n9s 5na0 5nad

(-) Related Entries Specified in the PDB File

5eh0 5EH0 CONTAINS THE SAME PROTEIN COMPLEXED WITH N2-(2-METHOXY-4-(1- METHYL-1H-PYRAZOL-4-YL)PHENYL)-N8-NEOPENTYLPYRIDO[3,4-D]PYRIMIDINE- 2,8-DIAMINE